The URL can be used to link to this page

Home My WebLink AboutSD-23-08 - Supplemental - 1170 1180 Dorset Street (3) ___________________________________ Blasting Plan For Park Road Commons _____________________________________ South Burlington, Vermont 05403 June, 2023 Prepared By: Maine Drilling & Blasting, Inc Western Construction 7190 State Route 40 Argyle, NY 12809 Telephone: 518 824-3309 Fax: 518 632 5716 Joe Happy / Cole Dube Division Manager / Project Engineer ___________________________________________ ___________________________________________ Name Title 1 Table of Contents General Pre-Blast Surveys Blast Monitoring Sequence of Blasting Blasting Procedures Blasting Mats Blast Area Security and Warning Signals Explosives Blaster Qualifications Blasting Personnel Licenses and Permits Blast Vibration Blast Reports Typical Blast Design 2 General Maine Drilling & Blasting, Inc. considers safety as the priority during all phases of blasting operations. We are knowledgeable of and will follow all local, state and federal regulations related to transportation and use of explosives. The project specifications and conditions have been reviewed. Details of procedures for pre-blast surveys, explosives use, blast security, monitoring and documentation are enclosed. Pre-Blast Surveys / Notifications Pre-blast surveys will be offered to all property owners within 250 foot radius of the blast site. Appropriate notices will be given and appointments arranged for those owners who desire a survey. Pre-blast surveys will be conducted by a Company Representative. Results of those surveys will be documented through video or still photographs and appropriate narration or written reports. Blast Monitoring All blasts will be monitored by a representative of Maine Drilling & Blasting, Inc. who has been properly trained in the setup and use of seismic monitoring equipment. At least one seismograph will be in use at all times. Placement of monitoring equipment will be at the nearest structure to the blast site. Maine Drilling & Blasting, Inc monitoring equipment will consist of Instantel type seismographs. Details are enclosed. Results of blast monitoring will typically be available before the next blast, usually immediately following a blast. Results can be reviewed and modifications can be made to the blast design for the next blast if necessary. Sequence of Blasting All blasting operations will be strictly coordinated with the contractor, engineers, and Fire Department. Emphasis will be on the safe and efficient removal of the rock existing on this project without impact to surrounding structures. Blasts will be developed so as to create adequate relief which will minimize ground vibrations and offer the greatest protection possible to the surrounding structures. Blasting Procedures 1. Blasting operations shall commence after 7:00 AM and cease before 5:00 PM, Monday through Friday. 2. Blasting cannot be conducted at times different from those announced in the blasting schedule except in emergencysituations, such as electrical storms or public safety required unscheduled detonation. 3. Warning and all-clear signals of different character that are audible within a range of one-quarter mile from the point ofthe blast shall be given. All persons within the permit area shall be notified of the meaning of the signals through appropriate instructions and signs posted. 4. Access to blasting area shall be regulated to protect the public from the effects of blasting. Access to the blasting are shall be controlled to prevent unauthorized entry before each blast and until the perimeter's authorized representative has determined that no unusual circumstances exist after the blast. Access to and travel in or through the area can then safely resume. 5. Areas in which charged holes are awaiting firing shall be guarded, barricaded and posted, or flagged againstunauthorized entry. 6. All blasts shall be made in the direction of the stress relieved face previously marked out or previously blasted. 7. All stemming shall be minimum as specified using clean, dry 3/8'' crushed stone. 3 8. Blasting mats shall be used as necessary to cover blasts. 9. The Blasting Contractor shall insure that extra safety and judgment is exercised by his blaster to prevent the simultaneous blasting of numerous holes. Blasting Mats Blasting mats and backfill will be used to control excessive amounts of rock movement when blasting in close proximity to structures. Placement and number of mats are typically determined by the blaster. Mats will be placed so as to protect all people and structures on, or surrounding the blast site and property. Rubber tire type blasting mats will be utilized on this project and will be approximately 12' x 24' in size; Rubber mat @ 12' x 24' 38 lbs./s.f. = 10,944 lbs./ea. Blast Security and Warning Whistles Each blast will be preceded by a security check of the affected area and then a series of warning whistles. Communications will be made with job site supervisors and local officials as required to ensure the safest possible operation. All personnel in the vicinity closest to the blast area will be warned. The warning whistles will follow the following sequence: 3 Audible Signal Pulses - 5 Minutes to Blast 2 Audible Signal Pulses - 1 Minute to Blast 1 Audible Signal Pulses - All Clear No blast will be fired until the area has been secured and determined safe. The blast site will be examined by the blaster prior to the all-clear signal to determine that it is safe to resume work. Explosives All explosives will be delivered to the job site on a daily basis. Only the amount of explosives required to perform the day's work will be brought to the site. All explosives will be stored in approved magazines when not in use. Enclosed are Technical Data and SDS sheets for the explosive products proposed for use on this project. Any one of, or a combination of these products may be in use at any one time on the site. Blaster Qualifications All Maine Drilling & Blasting, Inc. blasters on this job will be licensed in the State of Vermont and have received various amounts of training in the safe use and handling of explosives. Additionally, Maine Drilling & Blasting, Inc. blasters are familiar with all OSHA Regulations, State Regulations, and Federal Regulations regarding construction site safety, including transportation, use, and handling of explosive materials. Weekly safety meetings are to be held on site by the Maine Drilling & Blasting, Inc. job foreman, with a record of that meeting returned to the Maine Drilling & Blasting, Inc. office. 4 Blasting Personnel All blasting operations shall be conducted by experienced, trained and competent persons who understand the hazards involved. Persons working with explosive materials shall: 1. Have demonstrated knowledge of, and a willingness to comply with, safety and security requirements. 2. Be capable of using mature judgment in all situations. 3. Be of good physical condition and not addicted to intoxicants, narcotics, or other similar type of drugs. 4. The person(s) responsible for the explosives shall possess current knowledge of the local, State and Federal laws and regulations applicable to his work. 5. The person(s) responsible for the explosives shall have obtained a Certificate of Competency or a license as required by State law. Licenses and Permits Maine Drilling & Blasting, Inc. is fully licensed and insured for the transportation, use, and handling of explosives. Evidence of insurance is available. Blasting permits will be applied for as required from the local authorities by the Maine Drilling & Blasting, Inc. Blaster/Foreman when blasting is about to begin. Blast Vibration Blast vibration will be monitored at the blast site, typically at the structure(s) closet to the blast site. Vibration limits will closely follow industry limits and the State and Local Regulations. Blast designs will be modified as required to stay within the guidelines and meet project schedules as well. Blasting operations will be modified accordingly when approaching buildings and utilities. Enclosed are preliminary vibration calculations based on known distances to the structures of concern and anticipated initial blast designs. Ground vibration peak particle velocity limits shall not exceed USBM Alternative Blasting Criteria * US Bureau of Mines (USBM) RI 8507 Appendix B * Standard, and applicable State Regulations (VOSHA related to blasting, N.F.P.A. No. 295) Airblast overpressure level not to exceed 133 peak dB (linear) two Hertz high -pass system. Blast Reports Enclosed is a sample of a Maine Drilling & Blasting, Inc Blast Report. This report will be filled out for each blast and copies supplied as needed. Typical Blast Design Enclosed are what would be considered typical blast designs for this project. Hole sizes, depths, spacing and loading information is provided. These designs are to be considered a good starting point. Modifications are usually made, if necessary, following the first blasts to meet control and seismic considerations. 5 Blaster’s Licenses Drilling Equipment Surface drill rig for quarrying and construction Hole diameter: 45–102 mm FlexiROC T30 R Construction Edition The FlexiROC T30 R Construction Edition is a tophammer rig designed for a wide range of drilling applications. Extend your reach and versatility Excellent rig stability means operator safety and productivity Application versatility thanks to the COP 1640+ rock drill Extensive boom reach means fewer set ups Main benefits With Radio Remote Control, self-adjusting RPM and an extensive boom reach, the FlexiROC T30 R Construction Edition is versatile and extremely efficient. Powerful enough to drill into very hard rock. The rigs compact size means it can easily be transported from job to job – allowing you to maximize on the availability of your investment. 32 + Great reach and productivity With its extensive boom reach, the FlexiROC T30 R Construction Edition offers contractors savings in both time and money. Boom reach of 5 300 mm (with RAS or RHS) through an 80° radius translates into more holes from fewer set-ups. This versatility makes the FlexiROC T30 R Construction Edition an ideal choice for demanding construction jobs, such as road construction and foundation drilling. + Reliable and efficient The FlexiROC T30 R Construction Edition meets stringent Tier 4 Final engine emissions standards. Self-adjusting RPM ensure great efficiency and low diesel consumption. FlexiROC T30 R Construction Edition is equipped with the COP Logic system, which automatically adjusts impact and drill feed pressure to ensure optimal performance and increased service life of rock drilling tools. + Safer than ever The FlexiROC T30 R Construction Edition excels even in difficult terrain where its low center of gravity provide rugged mobility in all conditions. With Radio Remote Control as standard, the operator has full control over tramming and drilling while working at a safe distance from the rig – ideal for sites with limited access or unstable terrain. The FlexiROC T30 R Construction Edition can also be equipped with a hydraulic winch for secure anchoring on slopes up to 30°. Availability at your fingertips With great boom coverage that lets you drill more holes per set-up, the FlexiROC T30 R Construction Edition delivers true productivity. It is all in your hands with the 2.4 Ghz bluetooth Radio Remote Control. • Crawler type two speed undercarriage with track oscillation system • Cummins turbo charged diesel engine QSB4.5 Tier 4 Final • Atlas Copco screw type compressor • Folding boom system • Hydraulic rock drills COP 1840+, COP 1640+ • Alternative Rod Handling Systems, RHS • Dust Collection System, DCT • Radio Remote Control system with integrated display Technical specifications Main components Hole range (recommended) With Rod Adding System (RAS) or Rod Handling System (RHS) with 3.6 m (12’) rods and 4.3 m (14’) starter rod Threads Metric US Metric US Extra long folding boom R32, T35, TC35, T38, T45 Ø 45–89 mm Ø 1.75”–3.5”7.4 m (RAS) 14.8 m (RHS) 24’ (RAS) 48’ (RHS) Compressor Folding boom: Atlas Copco OIS, screw compressor Metric US Working pressure, max 8.5 bar 123 psi FAD, at normal working pressure 95 l/s 201 cfm Extra long folding boom: Atlas Copco OIS, screw compressor Working pressure, max 8.5 bar 123 psi FAD, at normal working pressure 80 l/s 170 cfm Hydraulic rock drill Rock drill Boom type Impact power Hydraulic pressure, max Impact rate RPM, max Torque, max Weight approx COP SC19 Folding boom 19 kW 25,5 hp 230 bar 3 336 psi 42–50 Hz 110 1 970 Nm 1 453 lbf/ft 174 kg 384 lb2151 070 Nm 789 lbf/ft COP SC16 Folding boom 16 kW 21.4 hp 200 bar 2 900 psi 55-73 Hz 135 1 550 Nm 1 143 lbf/ft 193 kg 425.5 lb2151 070 Nm 789 lbf/ft Extra long folding boom 340 670 Nm 494 lbf/ft Electrical system Voltage 24 V Batteries 2 x 12 V, 185 Ah Alternator 24 V, 70 Ah Work lights, front 2 x 70 W halogen Work lights, rear 2 x 70 W halogen Work lights, feed 2 x 70 W Display with diagnostics and settings Feed Extra long folding boom* Metric US Total length 6 000 mm 236” Travel length 4 070 mm 160” Feed extension 1 000 mm 39” Feed rate, max 0.9 m/s 3 ft/min Feed force, max 12 kN 2 697 lbf Tractive pull, max 15 kN 3 372 lbf * Hydraulic aluminium cylinder feed with hose guide and single drill steel supportwith moveable lower guide/dust hood.Hydraulic system Anti-jamming Rotation Pressure Control feed RPC-F Damper Pressure Control - impact DPC-I Return and drainage filters F (fltration rate) 16 μm absolute Hydraulic oil cooler max ambient temperature 50°C 122°F Dust collector DCT Metric US Filter area 8 m2 86 sq.ft Suction capacity at 500 mm wg 580 l/s 1 228 cfm Suction hose diameter 102/127 mm 4/5” Cleaning air pressure, max 7.5 bar 109 psi Cleaning air consumption at 7 bar 15 l/pulse 0.53 cu.ft/pulse Filter cleaning while drilling 2 pcs of filter elements Volumes Metric US Hydraulic oil tank 200 l 52.8 gal Hydraulic system, total 250 l 66.0 gal Compressor oil 20 l 5.3 gal Diesel engine oil 11 l 2.9 gal Diesel engine, fuel tank 270 l 71.3 gal Traction gear 3 l 0.8 gal Lubrication tank (ECL) 10 l 2.6 gal AdBlue 15 l 4.0 gal A comprehensive service offering Even the best equipment needs to be serviced regularly to make sure it sustains peak performance. An Epiroc service solution offers peace of mind, maximizing availability and performance throughout the lifetime of your equipment. We focus on safety, productivity and reliability. By combining genuine parts and an Epiroc service from our certified technicians, we safeguard your productivity – wherever you are. Engine Cummins turbo charged, diesel engine, QSB4.5, Tier 4 Final Power rating at 2000 rpm 116 kW/155 hp Electronic variable engine speed 870–2 030 rpm Variable fan control Green saver – automatic low engine speed 4 5 BMH 2000 cylinder feed with single drill rod support Technical specificationsTechnical specifications Radio Remote Control of all functions Drill control settings for different rock conditions Integrated display on Radio Remote Control with rig- and drilling status Built on well proven technology 2 950 4 200 2 800 H H L Height and length Extra long folding boom Height (H) 2 950 mm 116” Length (L) 9 200 mm 362” *Boom folded Feed height (H) Metric US Extra long folding boom 6 200 mm 244” Weight Standard unit excluding all options and drill steel Metric US Extra long folding boom 10 000 kg 22 050 Ib Horizontal reach and coverage area ABC Extra long folding boom 2 600 mm 5 300 mm 15 m2 A B C 40° 40°305 Vertical reach AB Extra long folding boom 3 700 mm 4 300 mm Normal position range in downwards directed- and toe hole drilling (folding boom) Normal position range in downwards directed drilling (extra long folding boom)Dumping angles AB Extra long folding boom 13° 50° Carrier• Hydraulic support leg • Hydraulic winch.• Cold start kit (-25 °C) • Diesel engine pre-heater • Extra LED work lights Feed• Silence Kit for reduced noise levels• Jaw set for R32/T38 sleeves for RAS arm • Jaw set for T45 sleeves for RAS arm• Rod rack with a capacity of three 3 660 mm (12’) rods (option on extra long folding boom only in combination with RAS) • Rod Handling System with a capacityof three 3 660 mm (12’) rods forextra long folding boom Hole measuring systems• Mechanical hole inclination instrument – ROCANGIE• Electronic hole inclination instrument with depth/sight/laser and auto feed alignment•GPS aiming device Lube oil and lube system• Thread greasing devise, type ECG (with oil)• Central lubrication system• Tropical hydraulic oil, ISO VG 68 • Artic hydraulic oil, ISO VG 32• Environmentally conformed hydraulic oil, ISO VG 46•ECL collection system Selection of options Dust control• Rubber disc for dust collector hood • Rubber skirt for dust collector hood• Water mist system including tank Delivered equipment, not mounted• Gas charging equipment for rock drill • Conversion kit R32• Conversion kit T38• Conversion kit T45 • Conversion kit T35/TC35 A B 35° 94° A B 2 410 37°37° 6 7 9868 0053 01a, 2019-04 Örebro, Sweden. Legal Notice © Copyright 2019, Epiroc Rock Drills AB, Örebro, Sweden. All product names in this publication are trademarks of Epiroc. Any unauthorized use or copying of the contents or any part thereof is prohibited. Illustrations and photos may show equipment with optional extras. No warranty is made regarding specifications or otherwise. Specifications and equipment are subject to change without notice. Consult your Epiroc Customer Center for specific information.United in performance. Inspired by innovation. Performance unites us, innovation inspires us, and commitment drives us to keep moving forward. Count on Epiroc to deliver the solutions you need to succeed today and the technology to lead tomorrow. epiroc.com >ŝŐŚƚŶŝŶŐWůĂŶ /LJKWQLQJ3URFHGXUHV $OOEODVWLQJRSHUDWLRQVVKDOOEHVXVSHQGHGDQGDOOSHUVRQVVKDOOEHUHPRYHGIURPWKHEODVWLQJ DUHDVGXULQJWKHDSSURDFKDQGSURJUHVVRIDQHOHFWULFDOVWRUP7KHEODVWVLWHVHFXULW\SURWRFRO ZLOOEHLQLWLDWHGDQGWKHDUHDZLOOEHVHFXUHG7KHIROORZLQJUXOHVPXVWEHIROORZHG $OLJKWQLQJGHWHFWRUVKRXOGEHXVHGWRPRQLWRUWKHSUR[LPLW\RIOLJKWQLQJWRWKHVKRW :KHQWKHVWRUPLVPLOHVGLVWDQWDVLGHQWLILHGE\WKHOLJKWQLQJGHWHFWRUQRWLI\DOOSHUVRQVLQ WKHEODVWLQJFUHZRIDSSURDFKLQJVWRUP6WRSDOOORDGLQJRIKROHVDQGHYDFXDWHDOOSHUVRQQHO H[FHSWEODVWHUDQGDVVLVWDQWWRDVDIHGLVWDQFHIURPWKHEODVWDUHD'HWDLOVRIWKHOLJKWQLQJ GHWHFWRUHTXLSPHQWDUHLQFOXGHGDVDQDWWDFKPHQWWRWKLVSODQ ,IWKHEODVWFDQQRWEHLQLWLDWHGEHIRUHWKHVWRUPDUULYHVZLWKLQPLOHVDVLQGLFDWHG E\WKHOLJKWQLQJGHWHFWRUWKHEODVWHUDQGDVVLVWDQWVKDOOHYDFXDWHWKHVLWHWRDVDIHGLVWDQFH 3HUVRQQHOPD\UHWXUQWRZRUNVLWHZKHQWKHVWRUPKDVSDVVHGDQGLVPLOHVGLVWDQW DVGHWHUPLQHGE\WKHOLJKWQLQJGHWHFWRURUDIWHUWKHFRPSOHWLRQRIEODVWZKLFKDOORZVIRU LQVSHFWLRQRIVLWHDQGRUPLVILUH ŝƌůĂƐƚǆƚƌĂƉŽůĂƚŽƌΘŝƌůĂƐƚWƌĞĚŝĐƚŝŽŶ $LUEODVW([WUDSRODWRU )RUXVHRQO\ZKHQWKHUHLVDDLUEODVWPHDVXUHPHQWDYDLODEOH LQWKHVDPHGLUHFWLRQDVWKHSRLQWRIFRQFHUQ (QWHU$%WKHDLUEODVWOHYHOPHDVXUHGLQG%/WRJHW36,SVLRI$% (QWHU',67GLVWDQFHWRWKHORFDWLRQRIWKHDLUEODVWPHDVXUHPHQW DQG',67GLVWDQFHWRSRLQWRIFRQFHUQWRH[WUDSRODWH36,SVL DQG$%G%DWSRLQWRIFRQFHUQ $%36,',67 ',6736,$% 2SHQDLUGHWRQDWLRQ ( 3HUNLQV-DFNVRQ 'HPROLWLRQDQGGHWFRUG $%36,',67 ',6736,$% &RDOPLQHSDUWLQJ ( 86%05, &RDORU4XDUU\$YHUDJH $%36,',67 ',6736,$% &RDOPLQHKLJKZDOO 86%05, &RDORUTXDUU\H[SHFWHG /%6 ',67 6'A36, '%/ /%6 ',67 6'A36, '%/ /%6 ',67 6'A36, '%/ $%36,',67 ',6736,$% $%36,',67 ',6736,$% $%36,',67 ',6736,$% G%/36, 6'A G%/36, 6'A G%/36, 6'A /%6 0D[LPXPDPRXQWRIH[SORVLYHVSHUGHOD\LQSRXQGV ',67 'LVWDQFHWRWKHSRLQWRIFRQFHUQ 6'A &XEHURRWVFDOHGGLVWDQFH $% ',67 'LVWDQFHWRWKHSRLQWRIWKHNQRZQDLUEODVWOHYHO ',67 'LVWDQFHWRWKHSRLQWRIWKHSRLQWRIFRQFHUQ 339 7KHNQRZQDLUEODVWOHYHO 339 7KHDLUEODVWOHYHODWWKHSRLQWRIFRQFHUQ 36, 6'A36, G%/ G%/:LQG9HORFLW\(TXLYDOHQW G%/03+ 3$57,1*5,&RDO&RQVWUXFWLRQRU4XDUU\:RUVW&DVH G%/GHFLEHOVOLQHDU7KHDERYHWKUHHIRUPXODHFDQEHXVHGLQWKHDEVHQFHRIDLUEODVWPHDVXUHPHQWV 23(1$,5'(721$7,21'HPROLWLRQ&RUG +,*+:$//5,&RDO&RQVWUXFWLRQRU4XDUU\$YHUDJH ,QDOOFDVHVHQWHU\RXUYDOXHVXQGHUWKHEROGHGODEHOVRYHUWKHVDPSOHYDOXHV (QWHUG%/WRVROYHIRU36,QHFHVVDU\WRGHWHUPLQHWKH6'ADWZKLFKWKHDLUEODVWOHYHOLVOLNHO\WRRFFXU8VHWRWKHDERYHIRUPXODHWRGHVLJQEODVWVWRWDUJHW +,*+:$//5,&RDO&RQVWUXFWLRQRU4XDUU\$YHUDJH 23(1$,5'(721$7,21'HPROLWLRQ&RUG +,*+:$//5,&RDO&RQVWUXFWLRQRU4XDUU\$YHUDJH 3$57,1*5,&RDO&RQVWUXFWLRQRU4XDUU\:RUVW&DVH (QWHU/%6SRXQGVRIH[SORVLYHVDQG',67GLVWDQFHWRSRLQWRIFRQFHUQWRVROYHIRU6'AFXEHURRWVFDOHGGLVWDQFHSVLSRXQGVVTXDUHLQFKDQG 8VHWKHDERYHWKUHHIRUPXODHRQO\ZKHQWKHUHLVDDLUEODVWPHDVXUHPHQWDYDLODEOHLQWKHVDPHGLUHFWLRQDV\RXUSRLQWRIFRQFHUQ 3$57,1*5,&RDO&RQVWUXFWLRQRU4XDUU\:RUVW&DVH DQG',67GLVWDQFHWRSRLQWRIFRQFHUQWRVROYHIRU36,SRXQGVVTXDUHLQFKRI$%DQG$%WKHDLUEODVWOHYHOSUHGLFWHGDW',67LQG%/ (QWHU$%WKHDLUEODVWOHYHOPHDVXUHGLQG%/WRVROYHIRU36,SRXQGVVTXDUHLQFKRI$%(QWHU',67GLVWDQFHWRWKHORFDWLRQRIWKHDLUEODVWPHDVXUHPHQW 23(1$,5'(721$7,21'HPROLWLRQ&RUG +,*+:$//5,&RDO&RQVWUXFWLRQRU4XDUU\$YHUDJH DGHVLUHGDLUEODVWOHYHO 23(1$,5'(721$7,21'HPROLWLRQ&RUG $LUEODVWUHSRUWHGLQGHFLEHOV $LUEODVWSUHVVXUHUHSRUWHGLQ36,SRXQGSHUVTXDUHLQFK 3$57,1*5,&RDO&RQVWUXFWLRQRU4XDUU\:RUVW&DVH Sample Blast Report **SUBMITTED DAILY ^ĂŵƉůĞƌŝůůŝŶŐ>ŽŐ^ŚĞĞƚ IME Blasting Best Practices Blasting Location Sketch Preblast SurveyDrawingInfastructureENGINEERINGSERVICES1170 & 1180 Dorset StreetSouth Burlington, VTPARK ROAD COMMONS250ft PREBLASTSURVEY RADIUS Seismograph Specifications } } } } } } − Fly Rock & Misfire Prevention Plans Typical Blast Design and Timing Diagrams Park Road Commons South Burlington, VT Western Job Owner/Site Customer Location: Division: Loaded Hole-Blast Design for: 6/15/2023 4:17 PM APENDIX A. - Blast Design Plan: Est. Number Of Holes:25 Hole Depth:9.00 Ft Hole Diameter:3.5 in Burden:5.00 Ft Spacing:5.00 Ft Holes per Delay:1 Pounds Per Delay:11.07 Lbs Pounds Per Hole:11.07 Lbs Total est. Pounds:276.75 Lbs Powder Factor:1.33 Lbs/Cy Decks:0 Author cdube On:6/15/2023 Updated By cdube On: 6/15/2023 Blast Plan Description:<6' Rock Cuts Blast Plan Notes: Vibration Prediction (formula based on Dupont Handbook) Site Factor (k) :160 Ground Constant based on Site/Rock Conidtions Distance Ft (d)75 Distance to Structure Lbs per Delay (w)11.07 Lbs explosives per 8 milisecond delay Scaled Distance (sd)22.54 ( sd = d/ square root of w) Estimated PPV 1.09 ( ppv = k * sd ^ -1.6) Typical for Production work consistent with holes 9 Ft deep at 75 from a structure utilizing 3.5' In diameter at a 5 Ft by 5 Ft pattern. Plan View/Timing Design (please see attached timing diagram) Loaded Hole Depth - Diameter - Product Park Road Commons South Burlington, VT Western Job Owner/Site Customer Location: Division: Loaded Hole-Blast Design for: 6/15/2023 4:18 PM APENDIX A. - Blast Design Plan: Est. Number Of Holes:25 Hole Depth:9.93 Ft Hole Diameter:3.5 in Burden:5.00 Ft Spacing:6.00 Ft Holes per Delay:1 Pounds Per Delay:14.01 Lbs Pounds Per Hole:14.01 Lbs Total est. Pounds:350.25 Lbs Powder Factor:1.27 Lbs/Cy Decks:0 Author cdube On:6/15/2023 Updated By cdube On: 6/15/2023 Blast Plan Description:>6' Rock Cuts Blast Plan Notes: Vibration Prediction (formula based on Dupont Handbook) Site Factor (k) :160 Ground Constant based on Site/Rock Conidtions Distance Ft (d)100 Distance to Structure Lbs per Delay (w)14.01 Lbs explosives per 8 milisecond delay Scaled Distance (sd)26.72 ( sd = d/ square root of w) Estimated PPV 0.83 ( ppv = k * sd ^ -1.6) Typical for Production work consistent with holes 9.93 Ft deep at 100 from a structure utilizing 3.5' In diameter at a 5 Ft by 6 Ft pattern. Plan View/Timing Design (please see attached timing diagram) Loaded Hole Depth - Diameter - Product Park Road Commons South Burlington, VT Western Job Owner/Site Customer Location: Division: Loaded Hole-Blast Design for: 6/15/2023 4:22 PM APENDIX A. - Blast Design Plan: Est. Number Of Holes:25 Hole Depth:9.00 Ft Hole Diameter:3.5 in Burden:5.00 Ft Spacing:4.00 Ft Holes per Delay:1 Pounds Per Delay:11.07 Lbs Pounds Per Hole:11.07 Lbs Total est. Pounds:276.75 Lbs Powder Factor:3.24 Lbs/Cy Decks:0 Author cdube On:6/15/2023 Updated By cdube On: 6/15/2023 Blast Plan Description:Outside Open Blast Plan Notes: Vibration Prediction (formula based on Dupont Handbook) Site Factor (k) :160 Ground Constant based on Site/Rock Conidtions Distance Ft (d)75 Distance to Structure Lbs per Delay (w)11.07 Lbs explosives per 8 milisecond delay Scaled Distance (sd)22.54 ( sd = d/ square root of w) Estimated PPV 1.09 ( ppv = k * sd ^ -1.6) Typical for Production work consistent with holes 9 Ft deep at 75 from a structure utilizing 3.5' In diameter at a 5 Ft by 4 Ft pattern. Plan View/Timing Design (please see attached timing diagram) Loaded Hole Depth - Diameter - Product SDS Sheets SDS Date: 03/16/2018 Page 1 of 9 Safety Data Sheet SECTION 1 – IDENTIFICATION Name, Address, and Telephone of the Responsible Party Maine Drilling & Blasting 88 Gold Ledge Ave, Auburn, NH 03032 Phone: (207) 582-2338 Toll Free: (800) 370-2338 Date: 03/16/2018 Supersedes: 08/24/2015 & 09/2005 Product Identifier Product Form: Mixture Product Name: 1966 Emulsion Blend Other Means of Identification Product Class: Emulsion Trade Names: 1966 Emulsion Blend Intended Use of the Product Industrial applications Emergency Telephone Numbers: DAY: 603-647-0299 FOR 24 HOUR EMERGENCY, CALL CHEMTREC (USA) 800-424-9300 CANUTEC (CANADA) 613-996-6666 SECTION 2 – HAZARD(S) IDENTIFICATION Classification of the Substance or Mixture Classification (GHS-US) Expl. 1.5 H205 Eye Irrit. 2A H319 Carc. 2 H351 STOT RE 2 H373 Label Elements GHS-US Labeling Hazard Pictograms (GHS-US) : GHS07 GHS08 Signal Word (GHS-US) : Danger Hazard Statements (GHS-US) : H205 - May mass explode in fire. H319 - Causes serious eye irritation. H351 – Contains materials suspected of causing cancer. H373 - May cause damage to organs through prolonged or repeated exposure. Precautionary Statements (GHS-US) : P201 - Obtain special instructions before use. P202 - Do not handle until all safety precautions have been read and understood. P210 - Keep away from heat, hot surfaces, open flames, sparks. - No smoking. P220 - Keep/Store away from combustible materials. P221 - Take any precaution to avoid mixing with combustible materials. Setting Earth Shattering Standards Since 1966 SDS Date: 03/16/2018 Page 2 of 9 Safety Data Sheet P240 - Ground/bond container and receiving equipment. Consult manufacturer for detailed guidance on appropriate grounding/bonding. P260 - Do not breathe dust, mist, vapors. P264 - Wash hands, forearms and exposed areas thoroughly after handling. P273 - Avoid release to the environment. P280 - Wear eye protection, protective clothing, protective gloves. P305+P351+P338 - IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing. P308+P313 - If exposed or concerned: Get medical advice/attention. P314 - Get medical advice/attention if you feel unwell. P337+P313 - If eye irritation persists: Get medical advice/attention. P370+P378 - In case of fire: Do NOT attempt to fight fire. P370+P380 - In case of fire: Evacuate area. P372 - Explosion risk in case of fire. P373 - DO NOT fight fire when fire reaches explosives. P401 - Store as defined in the Explosives Act of Canada and the provisions of the Bureau of Alcohol, Tobacco and Firearms regulations contained in 27 CFR Part 555.. P405 - Store locked up. P501 - Dispose of contents/container in accordance with local, regional, national, territorial, provincial, and international regulations. SECTION 3 - COMPOSITION/INFORMATION ON INGREDIENTS Mixture Name Product identifier % (w/w) Ingredient Classification (GHS-US) Ammonium nitrate (CAS No) 6484-52-2 65 - 90 Ox. Sol. 3, H272 Eye Irrit. 2A, H319 Fuel oil / mineral oil blend (CAS No) 68476-30-2 3 - 9 Flam. Liq. 3, H226 Acute Tox. 4 (Inhalation:dust,mist), H332 Skin Irrit. 2, H315 Carc. 2, H351 STOT RE 2, H373 Asp. Tox. 1, H304 Aquatic Acute 3, H402 Aquatic Chronic 2, H411 Polymeric Surfactant NA 0.5 – 2 Not available More than one of the ranges of concentration prescribed by Controlled Products Regulations has been used where necessary, due to varying composition. Ingredients, other than those mentioned above, as used in this product are not hazardous as defined under current Department of Labor regulations, or are present in deminimus concentrations (less than 0.1% for carcinogens, less than 1.0% for other hazardous materials). SECTION 4 - FIRST AID MEASURES Description of First Aid Measures General: Never give anything by mouth to an unconscious person. If you feel unwell, seek medical advice (show the label where possible). Inhalation: Remove to fresh air and keep at rest in a position comfortable for breathing. Obtain medical attention if breathing difficulty persists. Skin Contact: Remove contaminated clothing and wash before reuse. Gently wash with plenty of soap and water. Eye Contact: Rinse cautiously with water for at least 15 minutes. Remove contact lenses, if present and easy to do. Continue rinsing. Obtain medical attention if irritation develops or persists. SDS Date: 03/16/2018 Page 3 of 9 Safety Data Sheet Ingestion: Rinse mouth. Do not induce vomiting. Immediately call a POISON CENTER or doctor/physician. Most Important Symptoms and Effects Both Acute and Delayed General: May cause serious eye irritation. Contains material suspected of causing cancer. May cause damage to organs through prolonged or repeated exposure. Inhalation: May cause respiratory irritation. Skin Contact: May cause skin irritation. Eye Contact: May cause serious eye irritation. Ingestion: Ingestion is likely to be harmful or have adverse effects. Chronic Symptoms: Contains material suspected of causing cancer. May cause damage to organs through prolonged or repeated exposure. Indication of Any Immediate Medical Attention and Special Treatment Needed If exposed or concerned, get medical advice and attention. If ingested, causes methemoglobenemia – emergency response should treat appropriately, such as by intravenous administration of methylene blue. SECTION 5 - FIRE-FIGHTING MEASURES Extinguishing Media Suitable Extinguishing Media: DO NOT FIGHT FIRES INVOLVING EXPLOSIVES. Unsuitable Extinguishing Media: Do not attempt to fight fires involving explosive materials. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Special Hazards Arising From the Substance or Mixture Fire Hazard: Can explode or detonate under fire conditions. Burning material may produce toxic vapors. Explosion Hazard: Explosion risk in case of fire. This product is an explosive with mass detonation hazard. Heat may build pressure, rupturing closed containers, spreading fire and increasing risk of burns and injuries. Reactivity: Stable under normal conditions. May explode when subjected to fire, supersonic shock or high-energy projectile impact, especially when confined or in large quantities. Advice for Firefighters Firefighting Instructions: DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Can explode or detonate under fire conditions. Burning material may produce toxic vapors. Hazardous Combustion Products: Carbon Monoxide (CO) and Nitrogen Oxides (NOx) Reference to Other Sections: Refer to section 9 for flammability properties. SECTION 6 - ACCIDENTAL RELEASE MEASURES Personal Precautions, Protective Equipment and Emergency Procedures General Measures: Avoid all contact with skin, eyes, or clothing. Avoid breathing (vapor, mist, dust). For Non-Emergency Personnel Protective Equipment: Use appropriate personal protection equipment (PPE). Emergency Procedures: Evacuate unnecessary personnel. For Emergency Personnel Protective Equipment: Use appropriate personal protection equipment (PPE). Emergency Procedures: Stop release if safe to do so. Eliminate ignition sources. Ventilate area. Environmental Precautions Prevent entry to sewers and public waters. Methods and Material for Containment and Cleaning Up For Containment: Contain any spills with dikes to prevent migration and entry into sewers or streams. Do not use combustible absorbents and do not mix with other materials. Methods for Cleaning Up: Collect spillage for possible reuse. Clean up spills immediately and dispose of waste in accordance with appropriate Federal, State and local regulations. Reference to Other Sections See heading 8, Exposure Controls and Personal Protection SDS Date: 03/16/2018 Page 4 of 9 Safety Data Sheet SECTION 7 - HANDLING AND STORAGE Precautions for Safe Handling General: It is recommended that users of explosives material be familiar with the Institute of Makers of Explosives Safety Library publications. Comply with the safety library publication No. 4 “Warnings and Instructions” as adopted by the Institute of Makers of Explosives. Hygiene Measures: Handle in accordance with good industrial hygiene and safety procedures. Wash hands and forearms thoroughly after handling. Do not eat, drink or smoke when using this product. Conditions for Safe Storage, Including Any Incompatibilities Technical Measures: Contact manufacturer for appropriate grounding/bonding guidance. Comply with applicable regulations. Storage Conditions: Store as defined in the Explosives Act of Canada and the provisions of the Bureau of Alcohol, Tobacco and Firearms regulations contained in 27 CFR Part 555. Store in a dry, cool and well-ventilated place. Keep/Store away from direct sunlight, extremely high or low temperatures, heat sources, ignition sources. Keep container closed when not in use. Store locked up. Incompatible Materials: Strong acids. Strong bases. Strong oxidizers. Zinc. Copper and its alloys. Organic materials. Combustible materials. SECTION 8 - EXPOSURE CONTROLS/PERSONAL PROTECTION Control Parameters For substances listed in section 3 that are not listed here, there are no established exposure limits from the manufacturer, supplier, importer, or the appropriate advisory agency including: ACGIH (TLV), NIOSH (REL), or OSHA (PEL). Fuels, diesel, no. 2 (68476-30-2) USA ACGIH ACGIH TWA (mg/m³) 100 mg/m³ (inhalable fraction and vapor, as total hydrocarbons) 8 h (skin) USA ACGIH ACGIH chemical category Skin - potential significant contribution to overall exposure by the cutaneous route, Confirmed Animal Carcinogen with Unknown Relevance to Humans Exposure Controls Appropriate Engineering Controls: Ventilation System: Indoors: A system of local and / or general exhaust is recommended to keep employee exposures below the Airborne Exposure Limits. Local exhaust ventilation is generally preferred because it can control the emissions of the contaminant at its source, preventing dispersion of it into the general work area. Please refer to the ACGIH document, Industrial Ventilation, A Manual of Recommended Practices, most recent edition, for details. Use explosion-proof equipment. / Outdoors: Work upwind. Personal Protective Equipment: Personal Respirators (NIOSH Approved): A respirator is not needed under normal and intended conditions of use. If the exposure limit is exceeded and engineering controls are not feasible, use a mask with an organic vapor cartridge or positive pressure air supplied (SCBA) unit. Breathing air quality must meet the requirements of the OSHA respiratory protection standard (29CFR1910.134). Skin Protection: Gloves and additional protection including impervious boots, apron, or coveralls, as needed in areas of unusual exposure - Neoprene, PVC. Eye Protection: Use chemical safety goggles and / or a full face shield where splashing is possible. Hygiene Measures: Wash hands, forearms and face thoroughly after handling chemical products, before eating, smoking and using the lavatory and at the end of the working period. Appropriate techniques should be used to remove potentially contaminated clothing. Wash contaminated clothing before reusing. Ensure that eyewash stations and safety showers are close to the workstation location. SDS Date: 03/16/2018 Page 5 of 9 Safety Data Sheet SECTION 9 - PHYSICAL AND CHEMICAL PROPERTIES Information on Basic Physical and Chemical Properties Physical State : Solid Appearance : White to tan colored thick cream. If aluminim is present, gray metal particles will be visible. If ammonium nitrate prill is present, white to tan colored granules will be visible. Odor : Slight odor of fuel oil Odor Threshold : Not available pH : Not available Evaporation Rate : Not available Melting Point : Not available Freezing Point : Not available Boiling Point : Not available Flash Point : 165 °F (74 °C) (PMCC) Auto-ignition Temperature : Not available Decomposition Temperature : Not available Flammability (solid, gas) : Not available Lower Flammable Limit : Not available Upper Flammable Limit : Not available Vapor Pressure : Not available Relative Vapor Density at 20 °C : Not available Density : Not available Specific Gravity : 1.20 – 1.30 Solubility : Not available Partition Coefficient: N-Octanol/Water : Not available Viscosity : Not available Explosive properties : Explosive; fire, blast or projection hazard Explosion Data – Sensitivity to Mechanical Impact : Not expected to present an explosion hazard due to mechanical impact. Explosion Data – Sensitivity to Static Discharge : Not expected to present an explosion hazard due to static discharge. SECTION 10 - STABILITY AND REACTIVITY Reactivity: May cause or intensify fire; oxidizer. May accelerate the burning of other combustible materials. Contact with organic material or combustible material may cause an explosive situation. Chemical Stability: Stable under recommended handling and storage conditions (see section 7). May explode when subjected to fire, supersonic shock or high-energy projectile impact, especially when confined or in large quantities. Possibility of Hazardous Reactions: Hazardous polymerization will not occur. Conditions to Avoid: Avoid temperatures above (212°F (100°C). Incompatible Materials: Avoid all contamination, especially peroxides and chlorates. Alkaline contamination may liberate ammonia fumes. Hazardous Decomposition Products: Gaseous nitrogen oxides and carbon oxides: Toxic decomposition products including carbon monoxide (CO) may migrate to off blast-site areas. SECTION 11 - TOXICOLOGICAL INFORMATION Information on Toxicological Effects - Product Acute Toxicity: Not classified LD50 and LC50 Data: Not available SDS Date: 03/16/2018 Page 6 of 9 Safety Data Sheet Skin Corrosion/Irritation: Not classified Serious Eye Damage/Irritation: Causes serious eye irritation. Respiratory or Skin Sensitization: Not classified Germ Cell Mutagenicity: Not classified Teratogenicity: Not classified Carcinogenicity: Contains an ingredient suspected of causing cancer. Specific Target Organ Toxicity (Repeated Exposure): May cause damage to organs through prolonged or repeated exposure. Reproductive Toxicity: Not classified Specific Target Organ Toxicity (Single Exposure): Not classified Aspiration Hazard: Not classified Symptoms/Injuries After Inhalation: May cause respiratory irritation. Symptoms/Injuries After Skin Contact: May cause skin irritation. Symptoms/Injuries After Eye Contact: May cause serious eye irritation. Symptoms/Injuries After Ingestion: Ingestion is likely to be harmful or have adverse effects. Overexposure to this material may result in methemoglobinemia. Methemoglobinemia decreases the blood's ability to carry oxygen and results in symptoms such as dizziness, drowsiness, headache, shortness of breath, blue skin and lips, rapid heart rate, unconsciousness, and possibly death. Chronic Symptoms: Contains an ingredient suspected of causing cancer. May cause damage to organs through prolonged or repeated exposure. Information on Toxicological Effects - Ingredient(s) LD50 and LC50 Data: Fuels, diesel, no. 2 (68476-30-2) LD50 Oral Rat 18.7 - 24.9 ml/kg LD50 Dermal Rabbit > 4300 mg/kg ATE US (dust, mist) 3.60 mg/l/4h Ammonium nitrate (6484-52-2) LD50 Oral Rat 2217 mg/kg LC50 Inhalation Rat > 88.8 mg/l/4h SECTION 12: ECOLOGICAL INFORMATION Toxicity Ecology - General: This material is hazardous to the aquatic environment. Keep out of sewers and waterways. Ecology - Water: Harmful to aquatic life with long lasting effects. Fuels, diesel, no. 2 (68476-30-2) LC50 Fish 1 57 mg/l (Exposure time: 96 h - Species: Pimephales promelas [flow-through]) Persistence and Degradability Not available Bioaccumulative Potential Ammonium nitrate (6484-52-2) BCF fish 1 (no bioaccumulation expected) Log Pow -3.1 (at 25 °C) Mobility in Soil Not available Other Adverse Effects Other Information: Avoid release to the environment. SECTION 13 - DISPOSAL CONSIDERATIONS Waste Treatment Methods: Uncontaminated and contaminated material may be placed in large diameter boreholes and detonated so that the explosive energy is utilized as originally intended. Dispose of under direct supervision of a qualified person according to local, state and federal regulations. Call Maine Drilling & Blasting Safety and Compliance SDS Date: 03/16/2018 Page 7 of 9 Safety Data Sheet Department for recommendations and assistance. Additional Considerations: This material may become a hazardous waste under certain conditions and must be collected, labeled and disposed of per state and federal hazardous waste regulations. SECTION 14 - TRANSPORT INFORMATION In Accordance with DOT Proper Shipping Name : EXPLOSIVE, BLASTING, TYPE E (AGENT, BLASTING, TYPE E) Hazard Class : 1.5D Identification Number : NA0332 Label Codes : 1.5D Packing Group : II ERG Number : 140 In Accordance with IMDG Proper Shipping Name : EXPLOSIVE, BLASTING, TYPE E (AGENT, BLASTING, TYPE E) Hazard Class : 1 Identification Number : UN0332 Label Codes : 1.5D EmS-No. (Fire) : F-B EmS-No. (Spillage) : S-Y In Accordance with IATA Proper Shipping Name : AGENT, BLASTING TYPE E Identification Number : UN0332 Hazard Class : 1 Label Codes : 1.5D ERG Code (IATA) : 1L In Accordance with TDG Proper Shipping Name : EXPLOSIVE, BLASTING, TYPE E Packing Group : II Hazard Class : 1.5D Identification Number : UN0332 Label Codes : 1.5D SECTION 15 - REGULATORY INFORMATION US Federal Regulations MDB Blend 1966 SARA Section 311/312 Hazard Classes Immediate (acute) health hazard Delayed (chronic) health hazard Sudden release of pressure hazard Fire hazard Fuels, diesel, no. 2 (68476-30-2) Listed on the United States TSCA (Toxic Substances Control Act) inventory Ammonium nitrate (6484-52-2) Listed on the United States TSCA (Toxic Substances Control Act) inventory SARA Section 313 - Emission Reporting SDS Date: 03/16/2018 Page 8 of 9 Safety Data Sheet US State Regulations Fuels, diesel, no. 2 (68476-30-2) U.S. - New Hampshire - Regulated Toxic Air Pollutants - Ambient Air Levels (AALs) - 24-Hour U.S. - New Hampshire - Regulated Toxic Air Pollutants - Ambient Air Levels (AALs) - Annual U.S. - New Jersey - Discharge Prevention - List of Hazardous Substances U.S. - New Jersey - Environmental Hazardous Substances List RTK - U.S. - New Jersey - Right to Know Hazardous Substance List U.S. - California - Safer Consumer Products - Initial List of Candidate Chemicals and Chemical Groups U.S. - Texas - Effects Screening Levels - Long Term U.S. - Texas - Effects Screening Levels - Short Term Ammonium nitrate (6484-52-2) U.S. - Massachusetts - Right To Know List U.S. - New Jersey - Right to Know Hazardous Substance List U.S. - Pennsylvania - RTK (Right to Know) - Environmental Hazard List U.S. - Pennsylvania - RTK (Right to Know) List Canadian Regulations 1966 Emulsion Blend WHMIS Classication Note: Explosives are not regulated under WHMIS. They are subject to the regulations of the Explosives Act of Canada. Canadian Regulations MDB Blend 1966 WHMIS Classication Note: Explosives are not regulated under WHMIS. They are subject to the regulations of the Explosives Act of Canada. Fuels, diesel, no. 2 (68476-30-2) Listed on the Canadian DSL (Domestic Substances List) WHMIS Classification Class B Division 3 - Combustible Liquid Class D Division 2 Subdivision A - Very toxic material causing other toxic effects Class D Division 2 Subdivision B - Toxic material causing other toxic effects Class D Division 1 Subdivision B - Toxic material causing immediate and serious toxic effects Ammonium nitrate (6484-52-2) Listed on the Canadian DSL (Domestic Substances List) WHMIS Classification Class C - Oxidizing Material Class D Division 2 Subdivision B - Toxic material causing other toxic effects WHMIS Classification Class B Division 6 - Reactive Flammable Material Class B Division 4 - Flammable Solid SDS Date: 03/16/2018 Page 9 of 9 Safety Data Sheet Disclaimer Maine Drilling & Blasting and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, the information contained herein, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. The information contained herein is provided for reference purposes only and is intended only for persons having relevant technical skills. Because conditions and manner of use are outside of our control, the user is responsible for determining the conditions of safe use of the product. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product or information. Under no circumstances shall either Maine Drilling & Blasting or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. SECTION 16: OTHER INFORMATION, INCLUDING DATE OF PREPARATION OR LAST REVISION Revision Date : 08/24/2015 Other Information : This document has been prepared in accordance with the SDS requirements of the OSHA Hazard Communication Standard 29 CFR 1910.1200. Party Responsible for the Preparation of This Document Maine Drilling & Blasting 88 Gold Ledge Ave Auburn, NH 03032 Phone: (603) 647-0299 Toll Free: (800) 370-0299 Product Disclaimer: Please see reverse side. Properties SDS#1063 BLASTEX ® Small & Large Diameter Booster Sensitive Emulsion Hazardous Shipping Description • Explosive, Blasting, Type E, 1.5D, UN 0332 II BLASTEX BLASTEX PLUS Density (g/cc) Avg 1.26 1.26 Energya (cal/g) 740 800 (cal/cc) 930 1,010 Relative Weight Strengtha 0.84 0.91 Relative Bulk Strengtha,b 1.29 1.40 Velocityc (m/s) 5,000 4,900 (ft/s) 16,400 16,100 Detonation Pressurec (Kbars) 79 76 Gas Volumea (moles/kg) 44 39 Fume Class IME1 & NRCand IME1 Shelf Life Maximum 1 year from date of production Maximum Water Depth 45 m (150 ft) Water Resistance Excellent a All Dyno Nobel Inc. energy and gas volume values are calculated using PRODET™ the computer code developed by Dyno Nobel Inc. for its exclusive use. Other computer codes may give different values. b ANFO = 1.00 @ 0.82 g/cc c 8QFRQųQHG#PPLQGLDPHWHU d Approved by Natural Resources Canada as Fume Class 1 in:*valeron chub 50 mm (2 in) diameter and greater *shot bag 125 mm (5 in) diameter and greater PRODUCT DESCRIPTION BLASTEX is a booster sensitive, water resistant, packaged emulsion explosive designed to satisfy a majority of medium diameter explosive applications for quarry and construction blasting. It is a cost effective alternative to most detonator sensitive, water resistant, packaged emulsion explosives. BLASTEX is available in two grades with increasing energy level for each. APPLICATION RECOMMENDATIONS • Package diameter and type affect product density. Use cartridge count to determine actual explosive charge weight. • Ensure continuous column loading. For column lengths in excess of 6 m (20 ft) or whenever column separation is suspected, multiple priming is recommended. • Emulsion explosives are susceptible to “dynamic shock” and may detonate at low order or fail completely when applied in very wet conditions, where explosive charges or decks are closely spaced and/or where geological conditions promote this effect. Consult your Dyno Nobel representative for alternate product recommendations when these conditions exist. • ALWAYS use a cast booster as a primer for BLASTEX to ensure maximum performance. • ALWAYS use a 340 g (12 oz) or larger cast booster at internal product temperatures higher than -18º C (0º F). At internal product temperatures below -18º C (0º F) and higher than -34º C (-30º F) use a 454 g (16 oz) or larger cast booster. • NEVER use BLASTEX at internal product temperatures below -34º C (-30º F). At internal product temperatures below -34º C (-30º F), adequate product warm-up time must be allowed after loading into boreholes and before initiation. • Use with detonating cord is not recommended. ADDITIONAL INFORMATION – Visit dynonobel.com for Brochures and Case Studies related to this product. Properties Cont. Product Disclaimer: Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product. Under no circumstances shall Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or LQFLGHQWDOGDPDJHVRUIRUDQWLFLSDWHGORVVRISURųWV BLASTEX ® Small & Large Diameter Booster Sensitive Emulsion TRANSPORTATION, STORAGE AND HANDLING • BLASTEX and BLASTEX PLUS must be transported, stored, handled and used in conformity with all applicable federal, state, provincial and local laws and regulations. • Packaged emulsions have a shelf life of one (1) year when stored at temperatures between -18º C and 38º C (0º F and 100º F). Explosive inventory should be rotated. Avoid using new materials before the old. For recommended good practices in transporting, storing, handling and using this product, see the booklet “Prevention of Accidents in the Use of Explosive Materials” packed inside each case ad the Safety Library Publications of the Institute of Makers of Explosives. PACKAGING DETAILS • Package diameter and type affect product density. Use cartridge count to determine actual explosive charge weight. • All weights are approximate. • BLASTEX and BLASTEX PLUS are available in a wide variety of sizes. Custom sizes are subject to surcharge and may require longer than usual lead times. • Check with your Dyno Nobel representative should you have any questions. *Add two pounds for Gross Case Weight Case Dimensions 44 x 35 x 20 cm 17.25 x 13.875 x 7.875 in Diameter x Length Blastex Blastex Plus Case Qty Net Explosive Weight* Net Explosive Weight / Chub mm in kg lbs kg lbs 50 x 400 2 x 16 • • 18 18.0 40 1.00 2.20 57 x 400 2¼ x 16 • • 14 17.7 39 1.26 2.78 65 x 400 2½ x 16 • • 12 18.1 40 1.51 3.33 70 x 400 2¾ x 16 • • 9 17.3 38 1.92 4.23 75 x 400 3 x 16 • • 8 18.2 40 2.27 5.00 89 x 400 3½ x 16 • • 6 16.7 37 2.77 6.11 Packaging, Shot Bag Bag Diameter Bag Weight Tote Bag Quantitymm in kg lbs 125 5 11.3 25 40 Tote Bag Dimensions 84 x 84 x 94 cm 33 x 33 x 37 in Packaging, Chub SDS# 1063 Date: 07/20/2020 Page 1 of 8 Safety Data Sheet SECTION 1 –IDENTIFICATION Name, Address, and Telephone of the Responsible Party Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 Fax 801-321-6703 E-Mail: dnna.hse@am.dynonobel.com www.dynonobel.com SDS #:1063 Date:07/20/2020 Supersedes: 10/12/2018 Product Identifier Product Form: Mixture Product Name: Packaged Emulsion Explosives Trade Name(s): Synonyms: BLASTEX® BLASTEX®PLUS BLASTEX®TX Other Means of Identification Product Class:Emulsion Explosives, Packaged Intended Use of the Product: Industrial blasting applications Emergency Telephone Number FOR 24 HOUR EMERGENCY, CALL CHEMTREC (USA) 800-424-9300 CANUTEC (CANADA) 613-996-6666 SECTION 2 –HAZARD(S) IDENTIFICATION Classification of the Substance or Mixture Classification (GHS-US) Expl. 1.5 H205 Label Elements GHS-US Labeling Hazard Pictograms (GHS-US): GHS07 Signal Word (GHS-US):Danger Hazard Statements (GHS-US):H205 –May mass explode in fire Precautionary Statements (GHS-US):P210 - Keep away from heat, hot surfaces, open flames, sparks. - No smoking P264 - Wash exposed areas. thoroughly after handling P280 - Wear protective gloves/protective clothing/eye protection/face protection P305+P351+P338 - IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing P373 - DO NOT fight fire when fire reaches explosives P370+P380 - In case of fire: Evacuate area P372 - Explosion risk in case of fire P401 –Store as defined in the Explosives Act of Canada and the provisions of the Bureau of Alcohol, Tobacco and Firearms regulations contained in 27 CFR part 555. SDS# 1063 Date: 07/20/2020 Page 2 of 8 Safety Data Sheet P501 - Dispose of contents/container according to local, regional, national, and international regulations Other Hazards Hazards Not Otherwise Classified (HNOC): Not available Other Hazards: None SECTION 3 - COMPOSITION/INFORMATION ON INGREDIENTS Mixture Name Product identifier % (w/w)Ingredient Classification (GHS-US) Ammonium nitrate (CAS No) 6484-52-2 65 - 85 Ox. Sol. 3, H272 Eye Irrit. 2A, H319 Sodium nitrate (CAS No) 7631-99-4 0.1 –10 Ox. Sol. 3, H272 Acute Tox. 4 (Oral), H302 Eye Irrit. 2A, H319 Aluminum (CAS No) 7429-90-5 0.1 - 3 Comb. Dust, H232 Flam. Sol. 1, H228 Water-react. 2, H261 Mineral Oil (CAS No) 64742-54-7 0 –2 Asp. Tox. 1, H304 Wax (paraffin) (CAS No) 8002-72-2 0.0 –2.2 Not Classified Ingredients, other than those mentioned above, as used in this product are not hazardous as defined under current Department of Labor regulations or are present in deminimus concentrations (less than 0.1% for carcinogens, less than 1.0% for other hazardous materials). Full text of H-phrases: see section 16 SECTION 4 - FIRST AID MEASURES Description of First Aid Measures This is a packaged product that will not result in exposure to the contents under normal conditions of use. In the event of contact, administer first aid appropriate for symptoms present. General:Never give anything by mouth to an unconscious person. If exposed or concerned, seek medical advice and attention. Inhalation:Remove to fresh air and keep at rest in a position comfortable for breathing. Obtain medical attention if breathing difficulty persists. Skin Contact:Remove contaminated clothing. Gently wash with plenty of soap and water followed by rinsing with water for at least 15 minutes. Wash contaminated clothing before reuse. Eye Contact:Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing. Obtain medical attention if irritation develops or persists. Ingestion:Rinse mouth. Do not induce vomiting. Immediately call a POISON CENTER or doctor/physician. Most Important Symptoms and Effects Both Acute and Delayed General: Avoid ingestion, contact with eyes or skin. Inhalation: May cause respiratory irritation. Skin Contact: May cause skin irritation. Eye Contact: May cause serious eye irritation. Ingestion: Seek medical attention. Chronic Symptoms: None expected under normal conditions of use. Indication of Any Immediate Medical Attention and Special Treatment Needed If exposed or concerned, get medical advice and attention. SECTION 5 - FIRE-FIGHTING MEASURES Extinguishing Media Suitable Extinguishing Media:DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate SDS# 1063 Date: 07/20/2020 Page 3 of 8 Safety Data Sheet all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Unsuitable Extinguishing Media:DO NOT FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS Special Hazards Arising From the Substance or Mixture Fire Hazard:Can explode or detonate under fire conditions. Burning material may produce toxic vapors. Explosion Hazard:This product is an explosive with mass detonation hazard. Heating may cause an explosion. Reactivity:Stable under normal conditions, may explode when subjected to fire, supersonic shock or high-energy projectile impact, especially when confined or in a large quantity. Advice for Firefighters Firefighting Instructions:DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Guard against re-entry. Protection During Firefighting:See above Hazardous Combustion Products: Nitrogen Oxides (NOX), Carbon Monoxide (CO). Ammonia. Reference to Other Sections: Refer to section 9 for flammability properties. SECTION 6 - ACCIDENTAL RELEASE MEASURES Personal Precautions, Protective Equipment and Emergency Procedures General Measures: Avoid all contact with skin, eyes, or clothing. Keep away from heat/sparks/open flames/hot surfaces. No smoking. Eliminate every possible source of ignition. For Non-Emergency Personnel Protective Equipment: Use appropriate personal protection equipment (PPE). Emergency Procedures: Evacuate unnecessary personnel. For Emergency Personnel Protective Equipment: Use appropriate personal protection equipment (PPE). Emergency Procedures: Eliminate ignition sources. Ventilate area. Environmental Precautions Prevent entry to sewers and public waters. Methods and Material for Containment and Cleaning Up Methods for Cleaning Up: Protect from all ignition sources. If no fire danger is present, and product is undamaged and/or uncontaminated, pick up or sweep up and repackage product in original packaging or other clean DOT approved container. Ensure that a complete account of product has been made and is verified. Follow applicable Federal, State, and local spill reporting requirements. Reference to Other Sections See heading 8, Exposure Controls and Personal Protection. Concerning disposal elimination after cleaning, see section 13. SECTION 7 - HANDLING AND STORAGE Precautions for Safe Handling This is a packaged product that will not result in exposure to the contents under normal conditions of use. Additional Hazards When Processed: This product is an explosive and should only be used under the supervision of trained and licensed personnel. Use accepted safe industry practices when handling and using explosive materials. Unintended detonation of explosives or explosive devices can cause serious injury or death. Hygiene Measures: Handle in accordance with good industrial hygiene and safety procedures. Wash hands and other exposed areas with mild soap and water before eating, drinking, or smoking and again when leaving work. Do not eat, drink or smoke when using this product. Conditions for Safe Storage, Including Any Incompatibilities Technical Measures: Store as defined in the Explosives Act of Canada and the provisions of the Bureau of Alcohol, Tobacco and Firearms regulations contained in 27 CFR Part 555. Storage Conditions: Store in cool, dry, well-ventialated location. Store in compliance with Federal, State and local regulations. Keep away from heat, flame, ignition sources and strong shock. Do NOT store explosives in a detonator magazine or detonators in an explosive magazine. Keep containers closed. Explosives should be kept well away from initiating explosives; protected from physical damage; separated from oxidizing materials, combustibles, and sources of SDS# 1063 Date: 07/20/2020 Page 4 of 8 Safety Data Sheet SECTION 9 - PHYSICAL AND CHEMICAL PROPERTIES Information on Basic Physical and Chemical Properties Physical State :Solid Appearance :White or pink opaque semi-solid, which will appear gray if product contains aluminum. Typically paper or plastic chub packaging. Odor :Faint petroleum odor Odor Threshold :Not available pH :Not applicable Evaporation Rate :< 1 Melting Point :Not applicable Freezing Point :Not applicable Boiling Point :Not applicable Flash Point :Not applicable heat. Isolate from incompatibles. Incompatible Materials:Corrosives (strong acids and strong bases or alkalis) Specific End Use(s) For industrial blasting applications. SECTION 8 - EXPOSURE CONTROLS/PERSONAL PROTECTION Control Parameters Occupational Exposure Limits Ingredients:Product identifier:ACGIH TLV-TWA OSHA PEL-TWA Ammonium nitrate (CAS No) 6484-52-2 None None Sodium nitrate (CAS No) 7631-99-4 None None Aluminum (CAS No) 7429-90-5 10 mg/m3 (dust)15 mg/m3 (total) Mineral Oil (CAS No) 64742-54-7 5 mg/m3 (mist)5 mg/m3 (mist) Wax (paraffin) (CAS No) 8002-72-2 2-10 mg/m 3 (wax fume)None Ingredients, other than those mentioned above, as used in this product are not hazardous as defined under current Department of Labor regulations, or are present in deminimus concentrations (less than 0.1% for carcinogens, less than 1.0% for other hazardous materials). Exposure Controls Appropriate Engineering Controls:Ensure adequate ventilation, especially in confined areas. Ensure all national/local regulations are observed. Personal Protective Equipment:Gloves. Protective goggles. Protective clothing. Materials for Protective Clothing:protective clothing. Hand Protection:Protect against incidental skin contact. Eye Protection:Chemical goggles or safety glasses. Skin and Body Protection:Wear suitable protective clothing. Respiratory Protection:Use a NIOSH-approved respirator or self-contained breathing apparatus whenever exposure may exceed established Occupational Exposure Limits. Environmental Exposure Controls:Do not allow the product to be released into the environment. SDS# 1063 Date: 07/20/2020 Page 5 of 8 Safety Data Sheet Auto-ignition Temperature :Not available Decomposition Temperature :Ammonium nitrate: 210 °C (410 °F) Flammability (solid, gas):Not applicable Lower Flammable Limit :Not applicable Upper Flammable Limit :Not applicable Vapor Pressure :Not applicable Relative Vapor Density at 20 °C :Not applicable Relative Density :Not applicable Density :1.20 - 1.30 g/cc Specific Gravity :Not applicable Solubility :Partially soluble in water Partition coefficient: n-octanol/water :Not available Viscosity :Not available Explosive properties :Explosive; mass explosion hazard Explosion Data –Sensitivity to Mechanical Impact :Not sensitive Explosion Data –Sensitivity to Static Discharge :Not sensitive SECTION 10 - STABILITY AND REACTIVITY Reactivity:Stable under normal conditions, may explode when subjected to fire, supersonic shock or high-energy projectile impact, especially when confined or in a large quantity. Chemical Stability:Stable under normal temperature and pressure. Possibility of Hazardous Reactions: Hazardous polymerization will not occur. Conditions to Avoid:Keep away from heat, flame, ignition sources and strong shock. Incompatible Materials: Corrosives (strong acids and strong bases or alkalis). Hazardous Decomposition Products: Nitrogen Oxides (NOX), Carbon Monoxide (CO), Ammonia SECTION 11 - TOXICOLOGICAL INFORMATION Information on Toxicological Effects - Product Acute Toxicity: Not classified LD50 and LC50 Data: Not available Skin Corrosion/Irritation:Not classified Serious Eye Damage/Irritation:May cause eye irritation. Respiratory or Skin Sensitization:Not classified Germ Cell Mutagenicity:Not classified Teratogenicity: Not classified Carcinogenicity:Not classified Specific Target Organ Toxicity (Repeated Exposure): Not classified Reproductive Toxicity:Not classified Specific Target Organ Toxicity (Single Exposure):Not classified Aspiration Hazard:Not classified Symptoms/Injuries After Inhalation:May cause respiratory irritation. Symptoms/Injuries After Skin Contact:May cause skin irritation. Symptoms/Injuries After Eye Contact:Causes eye irritation. Symptoms/Injuries After Ingestion:If ingested, seek medical attention. Information on Toxicological Effects - Ingredient(s) LD50 and LC50 Data: Sodium nitrate (7631-99-4) SDS# 1063 Date: 07/20/2020 Page 6 of 8 Safety Data Sheet LD50 Oral Rat > 2000 mg/kg Ammonium nitrate (6484-52-2) LD50 Oral Rat 2217 mg/kg LC50 Inhalation Rat > 88.8 mg/l/4h SECTION 12: ECOLOGICAL INFORMATION Toxicity Not classified Sodium nitrate (7631-99-4) LC50 Fish 1 2000 mg/l (Exposure time: 96 h - Species: Lepomis macrochirus [static]) LC 50 Fish 2 994.4 - 1107 mg/l (Exposure time: 96 h - Species: Oncorhynchus mykiss [static]) Persistence and Degradability Sodium nitrate (7631-99-4) Persistence and Degradability Readily biodegradable in water. Bioaccumulative Potential Sodium nitrate (7631-99-4) Bioaccumulative Potential Not expected to bioaccumulate. Ammonium nitrate (6484-52-2) BCF fish 1 No bioaccumulation expected. Mobility in Soil Not available Other Adverse Effects Other Information: Avoid release to the environment. Toxicity Not classified SECTION 13 –DISPOSAL CONSIDERATIONS Waste Disposal Recommendations: Disposal must comply with Federal, State and local regulations. If product becomes a waste, it is potentially regulated as a hazardous waste as defined under the Resource Conservation and Recovery Act (RCRA) 40 CFR, part 261. Review disposal requirements with a person knowledgeable with applicable environmental law (RCRA) before disposing of any explosive material. Additional Information: None SECTION 14 - TRANSPORT INFORMATION 14.1 In Accordance with DOT Proper Shipping Name :EXPLOSIVE, BLASTING, TYPE E or Agent blasting, Type E Hazard Class :1.5D Identification Number :UN0332 Label Codes :1.5D Packing Group :II ERG Number :140 14.2 In Accordance with IMDG Proper Shipping Name :EXPLOSIVE, BLASTING, TYPE E (AGENT, BLASTING, TYPE E) Hazard Class :1.5D Identification Number :UN0332 . SDS# 1063 Date: 07/20/2020 Page 7 of 8 Safety Data Sheet Label Codes :1.5D EmS-No. (Fire):F-B EmS-No. (Spillage):S-Y 14.3 In Accordance with IATA Proper Shipping Name :AGENT, BLASTING TYPE E Identification Number :UN0332 Hazard Class :1 Label Codes :1.5D ERG Code (IATA):1L 14.4 In Accordance with TDG Proper Shipping Name :EXPLOSIVE, BLASTING, TYPE E Packing Group :II Hazard Class :1.5D Identification Number :UN0332 Label Codes :1.5D SECTION 15 - REGULATORY INFORMATION US Federal Regulations Packaged Emulsion Explosives Bureau of Alcohol Tobacco & Firearms (BATF) Department of Transportation (DOT) Mine Safety & Health Administration (MSHA) Canadian Regulations Packaged Emulsions WHMIS Classification Note: Explosives are not regulated under WHMIS. They are subject to the regulations of the Explosives Act of Canada. This product has been classified in accordance with the hazard criteria of the Controlled Products Regulations (CPR) and the SDS contains all of the information required by CPR. SECTION 16: OTHER INFORMATION, INCLUDING DATE OF PREPARATION OR LAST REVISION Revision date :07/20/2020 Other Information :This document has been prepared in accordance with the SDS requirements of the OSHA Hazard Communication Standard 29 CFR 1910.1200. GHS Full Text Phrases: Expl. 1.5 Explosive Category 1.5 H205 May mass explode in fire Party Responsible for the Preparation of This Document Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 SDS# 1063 Date: 07/20/2020 Page 8 of 8 Safety Data Sheet Disclaimer Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, the information contained herein, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. The information contained herein is provided for reference purposes only and is intended only for persons having relevant technical skills. Because conditions and manner of use are outside of our control, the user is responsible for determining the conditions of safe use of the product. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product or information. Under no circumstances shall either Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. Dyno Nobel SDS Product Disclaimer: Please see reverse side. TECHNICAL DATA SHEET NONEL® EZ DET 1.4B Nonelectric Blast Initiation System Properties SDS #1122 PRODUCT DESCRITION NONEL® nonelectric delay detonator EZ DET® 1.4B units consist of a length of orange shock tube with a surface detonator attached to one end and an in-hole, High Strength, detonator on the other. The surface detonator is inside a color-coded plastic EZ™ Connector block to facilitate easy connections to up to 6 shock tube leads. Easy-to-read, color-coded delay tags display the delay number and nominal firing time prominently. NONEL EZ DET units can be easily connected to one another to satisfy basic blast design requirements in construction, mining, and quarry operations. They can also be used in combination with NONEL MS, NONEL EZTL™ and/or NONEL TD detonators to satisfy complex blast design requirements and minimize inventory of initiation system components. APPLICATION RECOMMENDATIONS • For detailed application recommendations, ALWAYS request a copy of Dyno Nobel’s Product Manual: NONEL® and PRIMACORD® from your Dyno Nobel representative. • ALWAYS select a NONEL EZ DET unit having more than enough tubing length to extend from the planned primer location in the borehole to the collar of the next hole. • ALWAYS protect the plastic EZ Connector block and all shock tube leads from impact or damage during the loading and stemming operations. Use care when placing blasting mats and cover material on top of the blasting circuit. The EZ Connector block contains a detonator and is subject to detonation caused by abuse such as impact. Shock tube which has been cut, ruptured or damaged may cause misfires. • ALWAYS be sure that the shock tube(s) are securely inserted, one at a time, into the EZ Connector block. The head of the EZ Connector block should rise to accept the shock tube and return to a closed position with an audible click. Hazardous Shipping Description • Detonator assemblies nonelectric, 1.4B, UN 0361 PG II Net Explosive Content per 100 units 0.0810 kg 0.1785 lbs Nominal Time msec Nominal Time msec Nominal Time msec Connector Block Color 17 / 350 17 / 500 17 / 700 Yellow 25 / 350 25 / 500 25 / 700 Red 42 / 350 42 / 500 42 / 700 White 25 / 375 Red Note: This product is also available with a High Strength cap. For more information, please contact your local Dyno Nobel sales representative. This product is only available in the US Product Disclaimer: Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product. Under no circumstances shall Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. TECHNICAL DATA SHEET ADDITIONAL INFORMATION – Visit dynonobel.com for Brochures and Case Studies related to this product. Properties Cont. APPLICATION RECOMMENDATIONS - continued • ALWAYS ensure that individual shock tubes remain aligned side by side in the connector channel and do not cross one over the another on insertion. • NEVER use NONEL EZ DET units with detonating cord. The low strength surface detonator will not initiate detonating cord and may cause misfires. • NEVER attempt to disassemble the delay detonator from the plastic EZ Connector block or use the detonator without the connector. • NEVER place more than 6 shock tube leads into the plastic EZ Connector block. Misfires may result. • NEVER pull, stretch, kink or put tension on shock tube such that the tube could break. • NEVER splice NONEL EZ DET shock tube together to extend between holes. • NEVER connect NONEL EZ DET units together until all holes have been primed, loaded and stemmed and the blast site has been cleared. TRANSPORTATION, STORAGE AND HANDLING • NONEL EZ Det must be transported, stored, handled and used in conformity with all federal, state, provincial and local laws and regulations. • For maximum shelf life (3 years), NONEL EZ Det must be stored in a cool, dry, well ventilated magazine. Explosive inventory should be rotated. Avoid using new materials before the old. For recommended good practices in transporting, storing, handling and using this product, see the booklet “Prevention of Accidents in the Use of Explosive Materials” packed inside each case and the Safety Library Publications of the Institute of Makers of Explosives. Packaging Length Case Type Quantity/ Casemeters feet 3.5 12 D* 90 4.5 16 D* 60 724 D* 60 930 D* 40 12 40 D* 30 15 50 D* 30 18 60 D* 25 24 80 DC 40 30 100 DC 40 37 120 DC 30 • Length rounded to nearest one-half meter. • Case weight varies by length & delay; see case label for exact weight. * Always shipped with 2 cases strapped together. Case dimension width doubles. Case Dimensions Detpak Case (DC) 48 x 45 x 26 cm 18 ¾ x 17 ¾ x 10 ¾ in Detpak (D) 44 x 22 x 25 cm 17 ½ x 8 ¾ x 10 in NONEL® EZ DET 1.4B Nonelectric Blast Initiation System According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 1/18 Safety Data Sheet SECTION 1: IDENTIFICATION OF THE SUBSTANCE/MIXTURE AND OF THE COMPANY/UNDERTAKING Details of the supplier of the Safety Data Sheet Manufacturer/Supplier: Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 Fax: 801-321-6703 E-Mail: dnna.hse@am.dynonobel.com SDS #:1122 Date:07/20/2020 Supersedes: 05/22/2015 Product identifier Trade name: NONEL® Non-electric Delay Detonators Article number:1122 Other product identifiers: NONEL® MS NONEL® EZ DET® NONEL® MS ARCTIC NONEL®EZTL™ NONEL® LP NONEL® EZ DRIFTER® NONEL® SL NONEL® SUPER NONEL® TD NONEL® MS CONNECTOR NONEL® TWINPLEX™ NONEL® STARTER Relevant identified uses of the substance or mixture and uses advised against No further relevant information available. Application of the substance / the mixture Explosive product. Commercial blasting applications Emergency telephone number: CHEMTREC 1-800-424-9300 (US/Canada) +01 703-527-3887 (International) SECTION 2: HAZARDS IDENTIFICATION Classification of the substance or mixture Classification according to Regulation (EC) No 1272/2008 Classifications listed also are applicable to the OSHA GHS Hazard Communication Standard (29CFR1910.1200). exploding bomb Expl. 1.4 H204 Fire or projection hazard. Classification according to Directive 67/548/EEC or Directive 1999/45/EC R5: Heating may cause an explosion. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 2/18 Safety Data Sheet Information concerning particular hazards for human and environment:The product has to be labelled due to the calculation procedure of the "General Classification guideline for preparations of the EU" in the latest valid version. Classification system:The classification is according to the latest editions of the EU-lists, and extended by company and literature data. The classification is in accordance with the latest editions of international substances lists, and is supplemented by information from technical literature and by information provided by the company. Additional information:There are no other hazards not otherwise classified that have been identified. 0 percent of the mixture consists of component(s) of unknown toxicity Label elements Labelling according to Regulation (EC) No 1272/2008 The product is additionally classified and labelled according to the Globally Harmonized System within the United States (GHS). The product is classified and labelled according to the CLP regulation. Hazard pictograms GHS01 Signal word:Warning Hazard-determining components of labelling:diazodinitro phenol (DDNP) pentaerythritol tetranitrate (PETN) octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) lead diazide orange lead Hazard statements:H204 Fire or projection hazard. Precautionary statements: P210 Keep away from heat/sparks/open flames/hot surfaces. - No smoking. P250 Do not subject to grinding/shock/friction. P280 Wear protective gloves/protective clothing/eye protection/face protection. P240 Ground/bond container and receiving equipment. P373 DO NOT fight fire when fire reaches explosives. P370+P380 In case of fire: Evacuate area. P372 Explosion risk in case of fire. P401 Store in accordance with local/regional/national/international regulations. P501 Dispose of contents/container in accordance with local/regional/national/international regulations. Additional information:EUH201 Contains lead. Should not be used on surfaces liable to be chewed or sucked by children. Hazard description: WHMIS-symbols:Explosive products are not classified under WHMIS. NFPA ratings (scale 0 - 4):Not available. HMIS-ratings (scale 0 - 4):Not available. HMIS Long Term Health Hazard Substances 13424-46-9 lead diazide 7439-92-1 lead 13463-67-7 titanium dioxide 7758-97-6 lead chromate 7778-74-7 potassium perchlorate According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 3/18 Safety Data Sheet Other hazards Results of PBT and vPvB assessment PBT:Not applicable. vPvB:Not applicable. Explosive Product Notice:PREVENTION OF ACCIDENTS IN THE USE OF EXPLOSIVES - The prevention of accidents in the use of explosives is a result of careful planning and observance of the best known practices. The explosives user must remember that he is dealing with a powerful force and that various devices and methods have been developed to assist him in directing this force. He should realize that this force, if misdirected, may either kill or injure both him and his fellow workers. WARNING - All explosives are dangerous and must be carefully handled and used following approved safety procedures either by or under the direction of competent, experienced persons in accordance with all applicable federal, state, and local laws, regulations, or ordinances. If you have any questions or doubts as to how to use any explosive product, DO NOT USE IT before consulting with your supervisor, or the manufacturer, if you do not have a supervisor. If your supervisor has any questions or doubts, he should consult the manufacturer before use. SECTION 3: COMPOSITION/INFORMATION ON INGREDIENTS Mixtures Description:Mixture of substances listed below with nonhazardous additions. Dangerous components: CAS: 78-11-5 EINECS: 201-084-3 Index number: 603-035-00-5 pentaerythritol tetranitrate (PETN) E R3 Unst. Expl., H200 CAS: 13424-46-9 EINECS: 236-542-1 Index number: 082-003-00-7 lead diazide T Repr. Cat. 1, 3 R61; Xn R62-20/22; E R3; N R50/53 R33 Unst. Expl., H200 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 7439-92-1 EINECS: 231-100-4 lead T Repr. Cat. 1 R60-61-48/23/25; N R50/53 Repr. 1A, H360FD; STOT RE 1, H372 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 CAS: 7440-21-3 EINECS: 231-130-8 silicon F R11 Flam. Sol. 2, H228 CAS: 2691-41-0 EINECS: 220-260-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) T R24; Xn R22; E R2 Expl. 1.1, H201 Acute Tox. 3, H301; Acute Tox. 3, H311 CAS: 7782-49-2 EINECS: 231-957-4 Index number: 034-001-00-2 selenium T R23/25 R33-53 Acute Tox. 3, H301; Acute Tox. 3, H331 STOT RE 2, H373 Aquatic Chronic 4, H413 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 4/18 Safety Data Sheet CAS: 1314-41-6 EINECS: 215-235-6 Index number: 082-001-00-6 orange lead T Repr. Cat. 1, 3 R61;Xn R62-20/22;N R50/53 R33 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 10294-40-3 EINECS: 233-660-5 Index number: 056-002-00-7 barium chromate Xn R20/22 Carc. 1A, H350 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 7758-97-6 EINECS: 231-846-0 Index number: 082-004-00-2 lead chromate T Carc. Cat. 2, Repr. Cat. 1, 3 R45-61; Xn R62;N R50/53 R33 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 CAS: 4682-03-5 diazodinitro phenol (DDNP) Xi R36/38;Xi R43; E R3 Unst. Expl., H200 Skin Irrit. 2, H315; Eye Irrit. 2, H319; Skin Sens. 1, H317 CAS: 7440-36-0 EINECS: 231-146-5 antimony substance with a Community workplace exposure limit CAS: 7440-33-7 EINECS: 231-143-9 tungsten substance with a Community workplace exposure limit CAS: 7429-90-5 EINECS: 231-072-3 Index number: 013-001-00-6 aluminium powder (pyrophoric) F R15-17 Pyr. Sol. 1, H250; Water-react. 2, H261 CAS: 7439-98-7 EINECS: 231-107-2 molybdenum substance with a Community workplace exposure limit CAS: 61790-53-2 Diatomaceous earth (Silica-Amorphous) substance with a Community workplace exposure limit CAS: 7778-74-7 EINECS: 231-912-9 Index number: 017-008-00-5 potassium perchlorate Xn R22; O R9 Ox. Sol. 1, H271 Acute Tox. 4, H302 CAS: 7727-43-7 EINECS: 231-784-4 barium sulphate, natural substance with a Community workplace exposure limit SVHC 13424-46-9 lead diazide 1314-41-6 orange lead 7758-97-6 lead chromate Additional information:For the wording of the listed risk phrases refer to section 16. For the listed ingredients, the identity and exact percentages are being withheld as a trade secret. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 5/18 Safety Data Sheet SECTION 4:FIRST AID MEASURES Description of first aid measures General information:No special measures required. After inhalation:Unlikely route of exposure. Supply fresh air; consult doctor in case of complaints. After skin contact:Generally the product does not irritate the skin. Wash with soap and water. If skin irritation is experienced, consult a doctor. After eye contact:Remove contact lenses if worn. Rinse opened eye for several minutes under running water. If symptoms persist, consult a doctor. After swallowing:Unlikely route of exposure. Do not induce vomiting; call for medical help immediately. Most important symptoms and effects, both acute and delayed Blast injury if mishandled. Hazards Danger of blast or crush-type injuries. Indication of any immediate medical attention and special treatment needed Product may produce physical injury if mishandled. Treatment of these injuries should be based on the blast and compression effects. SECTION 5: FIREFIGHTING MEASURES Extinguishing media Suitable extinguishing agents:DO NOT fight fire when fire reaches explosives. For safety reasons unsuitable extinguishing agents: None. Special hazards arising from the substance or mixture DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Can explode or detonate under fire conditions. Burning material may produce toxic vapors. It is recommended that users of explosives material be familiar with the Institute of Makers of Explosives Safety Library publications. Fire or projection hazard. Product may explode if burned in confined space. Individual cartridges may explode. Mass explosion of many cartridges at once is unlikely. Advice for firefighters Protective equipment:Wear self-contained respiratory protective device. Wear fully protective suit. Additional information Eliminate all ignition sources if safe to do so. Flammability Classification: (defined by 29 CFR 1910.1200) Explosive. Can explode under fire conditions. Individual devices will randomly explode. Will not mass explode if multiple devices are involved. Burning material may produce toxic and irritating vapors. In unusual cases, shrapnel may be thrown from exploding devices under containment. See 2008 Emergency response Guidebook for further information. SECTION 6: ACCIDENTAL RELEASE MEASURES Personal precautions, protective equipment and emergency procedures Wear protective clothing. Ensure adequate ventilation Protect from heat. Environmental precautions: Do not allow to enter sewers/ surface or ground water. Inform respective authorities in case of seepage into water course or sewage system. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 6/18 Safety Data Sheet Methods and material for containment and cleaning up: Pick up mechanically. Send for recovery or disposal in suitable receptacles. Dispose unusable material as waste according to item 13. Reference to other sections See Section 7 for information on safe handling. See Section 8 for information on personal protection equipment. See Section 13 for disposal information. SECTION 7: HANDLING AND STORAGE Precautions for safe handling Handle with care. Avoid jolting, friction and impact. Use only in well ventilated areas. Do not subject to grinding/shock/friction. Information about fire - and explosion protection:Protect from heat. Emergency cooling must be available in case of nearby fire. Conditions for safe storage, including any incompatibilities Storage: Requirements to be met by storerooms and receptacles:Store in a cool location. Avoid storage near extreme heat, ignition sources or open flame. Information about storage in one common storage facility:Store away from foodstuffs. Further information about storage conditions:Store in cool, dry conditions in well sealed receptacles. Keep away from heat. Specific end use(s)No further relevant information available. SECTION 8: EXPOSURE CONTROLS/PERSONAL PROTECTION Additional information about design of technical facilities: No further data; see item 7. Control parameters Ingredients with limit values that require monitoring at the workplace: 13424-46-9 lead diazide PEL (USA)Long-term value: 0,05 mg/m³ as Pb; See 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ as Pb;*8-hr TWA; See Pocket Guide App. C TLV (USA)Long-term value: 0,05 mg/m³ as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ as Pb; IARC 2A, R 7439-92-1 lead PEL (USA)Long-term value: 0,05* mg/m³ *see 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ *8-hr TWA,excl. lead arsenate; See PocketGuideApp.C TLV (USA)Long-term value: 0,05* mg/m³ *and inorganic compounds, as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ R; IARC 2B According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 7/18 Safety Data Sheet EV (Canada)Long-term value: 0,05 mg/m³ as Pb, Skin (organic compounds) 7440-21-3 silicon PEL (USA)Long-term value: 15* 5** mg/m³ *total dust **respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ *total dust **respirable fraction TLV (USA)TLV withdrawn EL (Canada)Long-term value: 10* 3** mg/m³ *total dust;**respirable fraction EV (Canada)Long-term value: 10 mg/m³ total dust 7782-49-2 selenium PEL (USA)Long-term value: 0,2 mg/m³ as Se REL (USA)Long-term value: 0,2 mg/m³ as Se TLV (USA)Long-term value: 0,2 mg/m³ as Se EL (Canada)Long-term value: 0,1 mg/m³ EV (Canada)Long-term value: 0,2 mg/m³ 1314-41-6 orange lead PEL (USA)Long-term value: 0,05 mg/m³ as Pb; See 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ as Pb;*8-hr TWA; See Pocket Guide App. C TLV (USA)Long-term value: 0,05 mg/m³ as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ as Pb; IARC 2A, R EV (Canada)Long-term value: 0,05 mg/m³ as Pb, Skin (organic compounds) 13463-67-7 titanium dioxide PEL (USA)Long-term value: 15* mg/m³ *total dust REL (USA)See Pocket Guide App. A TLV (USA)Long-term value: 10 mg/m³ withdrawn from NIC EL (Canada)Long-term value: 10* 3** mg/m³ *total dust;**respirable fraction; IARC 2B EV (Canada)Long-term value: 10 mg/m³ total dust 10294-40-3 barium chromate PEL (USA)Long-term value: 0,005* mg/m³ Ceiling limit: 0,1** mg/m³ *as Cr(VI) **as CrO3; see 29 CFR 1910,1026 REL (USA)Long-term value: 0,0002 mg/m³ as Cr; See Pocket Guide Apps. A and C TLV (USA)Long-term value: 0,01 mg/m³ as Cr According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 8/18 Safety Data Sheet EL (Canada)Long-term value: 0,01 mg/m³ as Cr; ACGIH A1 IARC 1 7758-97-6 lead chromate IOELV (EU)Long-term value: 2 mg/m³ as Cr PEL (USA)Long-term value: 0,005* mg/m³ Ceiling limit: 0,1** mg/m³ *as Cr(VI) **as CrO3; see 29 CFR 1910,1026 REL (USA)Long-term value: 0,0002 mg/m³ as Cr; See Pocket Guide Apps. A and C TLV (USA)Long-term value: 0,05* 0,012** mg/m³ *as Pb; BEI ; **as Cr EL (Canada)Long-term value: 0,05* 0,012** mg/m³ ACIGH A2, IARC 2A; R; *as Pb;**as Cr EV (Canada)Long-term value: 0,012* 0,05** mg/m³ *as Cr, **as Pb 7727-43-7 barium sulphate, natural PEL (USA)Long-term value: 15* 5** mg/m³ *total dust **respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ *total dust **respirable fraction TLV (USA)Long-term value: 5* mg/m³ *inhalable fraction; E EL (Canada)Long-term value: 10* 3** mg/m³ *total dust, **respirable fraction EV (Canada)Long-term value: 10 mg/m³ total dust 61790-53-2 Diatomaceous earth (Silica-Amorphous) PEL (USA)20mppcf or 80mg/m3 /%SiO2 REL (USA)Long-term value: 6 mg/m³ See Pocket Guide App. C TLV (USA)TLV withdrawn EL (Canada)Long-term value: 4* 1,5** mg/m³ *total, **respirable EV (Canada)Long-term value: 10* 3** mg/m³ uncalcined; *inhalable;**respirable 7439-98-7 molybdenum PEL (USA)Long-term value: 15* mg/m³ *Total dust TLV (USA)Long-term value: 10* 3** mg/m³ as Mo; *inhalable fraction ** respirable fraction EL (Canada)Long-term value: 3* 10** mg/m³ as Mo; *respirable **inhalable EV (Canada)Long-term value: 10* 3** 0,5*** mg/m³ metal,insol.compd.:*inh;**resp;sol.compd.:***resp 7440-33-7 tungsten PEL (USA)and insoluble compounds, as We REL (USA)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 9/18 Safety Data Sheet TLV (USA)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W EL (Canada)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W EV (Canada)Short-term value: 10* 3** mg/m³ Long-term value: 5* 1** mg/m³ (as tungsten; compds.:*water-insol.;**water-sol. 7429-90-5 aluminium powder (pyrophoric) PEL (USA)Long-term value: 15*; 15** mg/m³ *Total dust; ** Respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ as Al*Total dust**Respirable/pyro powd./welding f. TLV (USA)Long-term value: 1* mg/m³ as Al; *as respirable fraction EL (Canada)Long-term value: 1,0 mg/m³ respirable, as Al EV (Canada)Long-term value: 5 mg/m³ aluminium-containing (as aluminium) 7440-36-0 antimony PEL (USA)Long-term value: 0,5 mg/m³ as Sb REL (USA)Long-term value: 0,5 mg/m³ as Sb TLV (USA)Long-term value: 0,5 mg/m³ as Sb EL (Canada)Long-term value: 0,5 mg/m³ EV (Canada)Long-term value: 0,5 mg/m³ DNELs No further relevant information available. PNECs No further relevant information available. Ingredients with biological limit values: 13424-46-9 lead diazide BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 7439-92-1 lead BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10 μg/100 ml Medium: blood Time: not critical According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 10/18 Safety Data Sheet Parameter: Lead (women of child bearing potential) 1314-41-6 orange lead BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10294-40-3 barium chromate BEI (USA)25 μg/L Medium: urine Time: end of shift at end of workweek Parameter: Total chromium (fume) 10 μg/L Medium: urine Time: increase during shift Parameter: Total chromium (fume) 7758-97-6 lead chromate BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10 μg/100 ml Medium: blood Time: not critical Parameter: Lead (women of child bearing potential) Additional information:The lists valid during the making were used as basis. Exposure controls Personal protective equipment: General protective and hygienic measures: The usual precautionary measures are to be adhered to when handling chemicals. Keep ignition sources away - Do not smoke. Keep away from foodstuffs, beverages and feed. Wash hands before breaks and at the end of work. Respiratory protection: Not required under normal conditions of use. Respiratory protection may be required after product use. Protection of hands: Wear gloves for the protection against mechanical hazards according to NIOSH or EN 388. Material of gloves: The selection of the suitable gloves does not only depend on the material, but also on further marks of quality and varies from manufacturer to manufacturer. As the product is a preparation of several substances, the resistance of According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 11/18 Safety Data Sheet SECTION 9: PHYSICAL AND CHEMICAL PROPERTIES Information on basic physical and chemical properties General Information Appearance: Form:Solid material Colour:According to product specification Odour:Odourless Odour threshold:Not determined. pH-value:Not applicable. Change in condition Melting point/Melting range:Not determined. Boiling point/Boiling range:Undetermined. Flash point:Not applicable. Flammability (solid, gaseous):Fire or projection hazard. Auto/Self-ignition temperature:Not determined. Decomposition temperature:Not determined. Self-igniting:Product is not self-igniting. Danger of explosion:Heating may cause an explosion. Explosion limits: Lower:Not determined. Upper:Not determined. Vapour pressure:Not applicable. Density:Not determined. Relative density Not determined. Vapour density Not applicable. Evaporation rate Not applicable. Solubility in / Miscibility with water:Variable, dependent upon product composition and packaging. Partition coefficient (n-octanol/water):Not determined. Viscosity: Dynamic:Not applicable. Kinematic:Not applicable. Other information No further relevant information available. the glove material can not be calculated in advance and has therefore to be checked prior to the application. Penetration time of glove material: The exact break through time has to be found out by the manufacturer of the protective gloves and has to be observed. Eye protection: Face protection Safety glasses Body protection: Impervious protective clothing Limitation and supervision of exposure into the environment: No further relevant information available. Risk management measures: Organizational measures should be in place for all activities involving this product. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 12/18 Safety Data Sheet SECTION 10: STABILITY AND REACTIVITY Reactivity Chemical stability Thermal decomposition / conditions to be avoided:No decomposition if used and stored according to specifications. Keep away from heat/sparks/open flames/hot surfaces. - No smoking. Possibility of hazardous reactions Danger of explosion. Toxic fumes may be released if heated above the decomposition point. Reacts violently with oxidising agents. Conditions to avoid Keep ignition sources away - Do not smoke. Incompatible materials: No further relevant information available. Hazardous decomposition products: Carbon monoxide and carbon dioxide Hydrocarbons Leadoxide vapour Bariumoxide vapour Toxic metal oxide smoke Chlorine compounds Danger of forming toxic pyrolysis products. Nitrogen oxides SECTION 11: TOXICOLOGICAL INFORMATION Information on toxicological effects Acute toxicity: LD/LC50 values relevant for classification: 7439-92-1 lead Oral LD50 >2000 mg/kg (rat) 7782-49-2 selenium Oral LD50 6700 mg/kg (rat) 7758-97-6 lead chromate Oral LD50 12000 mg/kg (mouse) Primary irritant effect: on the skin:Not a skin irritant in unused form. Vapors/particles from used product are possibly irritating to skin. on the eye:Not an eye irritant in unused form. Vapors/particles from used product are possibly irritating to eyes. Sensitisation:No sensitising effects known. Subacute to chronic toxicity:No further relevant information available. Acute effects (acute toxicity, irritation and corrosivity):Danger of blast or crush-type injuries. Repeated dose toxicity:Contains known or suspect carcinogens when inhaled. Product is in non-inhalable form and is nonclassifiable as a carcinogen. CMR effects (carcinogenity, mutagenicity and toxicity for reproduction):Contains known or suspect carcinogens when inhaled. Product is in non-inhalable form and is non- classifiable as a carcinogen. SECTION 12: ECOLOGICAL INFORMATION Toxicity Aquatic toxicity:Toxic for aquatic organisms Persistence and degradability:No further relevant information available. Bioaccumulative potential:May be accumulated in organism Mobility in soil:No further relevant information available. Ecotoxical effects: Remark: Toxic for fish According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 13/18 Safety Data Sheet Additional ecological information: General notes:Water hazard class 3 (German Regulation) (Self-assessment): extremely hazardous for water Do not allow product to reach ground water, water course or sewage system, even in small quantities. Danger to drinking water if even extremely small quantities leak into the ground. Also poisonous for fish and plankton in water bodies. The product contains heavy metals. Avoid transfer into the environment. Specific preliminary treatments are necessary Toxic for aquatic organisms Due to available data on eliminability/decomposition and bioaccumulation potential prolonged term damage of the environment can not be excluded. Results of PBT and vPvB assessment PBT:Not applicable. vPvB: Not applicable. Other adverse effects:No further relevant information available. SECTION 13: DISPOSAL CONSIDERATIONS Waste treatment methods: Recommendation: Must not be disposed together with household garbage. Do not allow product to reach sewage system. Damaged materials pose a danger to anyone in the immediate area; consult experts for disposal of damaged products. The user of this material has the responsibility to dispose of unused material, residues and containers in compliance with all relevant local, state and federal laws and regulations regarding treatment, storage and disposal for hazardous and nonhazardous wastes. Residual materials should be treated as hazardous. Uncleaned packaging: Recommendation:Disposal must be made according to official regulations. SECTION 14: TRANSPORT INFORMATION UN-Number DOT, ADR, IMDG, IATA UN0361 UN proper shipping name DOT Detonator assemblies, non-electric ADR 0361 DETONATOR ASSEMBLIES, NONELECTRIC, IMDG DETONATOR ASSEMBLIES, NONELECTRIC, IATA DETONATOR ASSEMBLIES, NON-ELECTRIC Transport hazard class(es) DOT, ADR, IMDG, IATA Class Label 1.4 1.4B Packing group DOT, ADR, IMDG, IATA II Environmental hazards: Marine pollutant:No According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 14/18 Safety Data Sheet Special marking (IATA): Cargo Aircraft Only. Prohibited from Transport in Passenger Aircraft. Special precautions for user Not applicable. EMS Number: Segregation groups F-B, S-X Lead and its compounds Transport in bulk according to Annex II of MARPOL73/78 and the IBC Code Transport/Additional information: Not applicable. ADR Limited quantities (LQ)0 Excepted quantities (EQ)Code: EO Tunnel restriction code 2 (E) IMDG Limited quantities (LQ)0 Excepted quantities (EQ)Code: EO UN “Model Regulation”:UN 0361, DETONATOR ASSEMBLIES, NONELECTRIC, 1.4B, II SECTION 15: REGULATORY INFORMATION Safety, health and environmental regulations/legislation specific for the substance or mixture United States (USA) SARA Section 355 (extremely hazardous substances): None of the ingredients are listed. Section 313 (Specific toxic chemical listings): 13424-46-9 lead diazide 7439-92-1 lead 7782-49-2 selenium 1314-41-6 orange lead 10294-40-3 barium chromate 7758-97-6 lead chromate 7727-43-7 barium sulphate, natural 7429-90-5 aluminium powder (pyrophoric) 7440-36-0 antimony TSCA (Toxic Substances Control Act): All ingredients are listed. Proposition 65 (California): Chemicals known to cause cancer: 13424-46-9 lead diazide 7439-92-1 lead 1314-41-6 orange lead According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 15/18 Safety Data Sheet 13463-67-7 titanium dioxide 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause reproductive toxicity for females: 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause reproductive toxicity for males: 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause developmental toxicity: 13424-46-9 lead diazide 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Carcinogenic Categories EPA (Environmental Protection Agency) 13424-46-9 lead diazide B2 7439-92-1 lead B2 7782-49-2 selenium D 1314-41-6 orange lead B2 10294-40-3 barium chromate A(inh), D(oral), K/L(inh), CBD(oral) 7758-97-6 lead chromate K 7727-43-7 barium sulphate, natural D, CBD(inh), NL(oral) 7778-74-7 potassium perchlorate NL 2691-41-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX)D IARC (International Agency for Research on Cancer) 13424-46-9 lead diazide 2A 7439-92-1 lead 2B 7782-49-2 selenium 3 1314-41-6 orange lead 2A 13463-67-7 titanium dioxide 2B 10294-40-3 barium chromate 1 7758-97-6 lead chromate 1 61790-53-2 Diatomaceous earth (Silica-Amorphous)3 TLV (Threshold Limit Value established by ACGIH) 13424-46-9 lead diazide A3 7439-92-1 lead A3 1314-41-6 orange lead A3 13463-67-7 titanium dioxide A4 10294-40-3 barium chromate A1 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 16/18 Safety Data Sheet 7758-97-6 lead chromate A2 7439-98-7 molybdenum A3 7429-90-5 aluminium powder (pyrophoric)A4 NIOSH-Ca (National Institute for Occupational Safety and Health) 13463-67-7 titanium dioxide 10294-40-3 barium chromate 7758-97-6 lead chromate Canada Canadian Domestic Substances List (DSL) Some components are listed on the NDSL. All ingredients are listed. Canadian Ingredient Disclosure list (limit 0.1%) 7439-92-1 lead 7782-49-2 selenium 10294-40-3 barium chromate 7758-97-6 lead chromate Canadian Ingredient Disclosure list (limit 1%) 7439-98-7 molybdenum 7440-33-7 tungsten 7429-90-5 aluminium powder (pyrophoric) 7440-36-0 antimony Other regulations, limitations and prohibitive regulations Thisproducthasbeenclassifiedin accordancewithhazardcriteriaof theControlledProducts Regulations and the SDS contains all the information required by the Controlled Products Regulations. Substances of very high concern (SVHC) according to REACH, Article 57 13424-46-9 lead diazide 1314-41-6 orange lead 7758-97-6 lead chromate Chemical safety assessment: A Chemical Safety Assessment has not been carried out. SECTION 16: OTHER INFORMATION Relevant phrases H200 Unstable explosives. H201 Explosive; mass explosion hazard. H228 Flammable solid. H250 Catches fire spontaneously if exposed to air. H261 In contact with water releases flammable gases. H271 May cause fire or explosion; strong oxidiser. H301 Toxic if swallowed. H302 Harmful if swallowed. H311 Toxic in contact with skin. H315 Causes skin irritation. H317 May cause an allergic skin reaction. H319 Causes serious eye irritation. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 17/18 Safety Data Sheet H331 Toxic if inhaled. H332 Harmful if inhaled. H350 May cause cancer. H360Df May damage the unborn child. Suspected of damaging fertility. H360FD May damage fertility. May damage the unborn child. H372 Causes damage to organs through prolonged or repeated exposure. H373 May cause damage to organs through prolonged or repeated exposure. H400 Very toxic to aquatic life. H410 Very toxic to aquatic life with long lasting effects. H413 May cause long lasting harmful effects to aquatic life. R11 Highly flammable. R15 Contact with water liberates extremely flammable gases. R17 Spontaneously flammable in air. R2 Risk of explosion by shock, friction, fire or other sources of ignition. R20/22 Harmful by inhalation and if swallowed. R22 Harmful if swallowed. R23/25 Toxic by inhalation and if swallowed. R24 Toxic in contact with skin. R3 Extreme risk of explosion by shock, friction, fire or other sources of ignition. R33 Danger of cumulative effects. R36/38 Irritating to eyes and skin. R43 May cause sensitisation by skin contact. R45 May cause cancer. R48/23/25 Toxic: danger of serious damage to health by prolonged exposure through inhalation and if swallowed. R50/53 Very toxic to aquatic organisms, may cause long-term adverse effects in the aquatic environment. R53 May cause long-term adverse effects in the aquatic environment. R60 May impair fertility. R61 May cause harm to the unborn child. R62 Possible risk of impaired fertility. R9 Explosive when mixed with combustible material. Abbreviations and acronyms: ADR: Accord européen sur le transport des marchandises dangereuses par Route (European Agreement concerning the International Carriage of Dangerous Goods by Road) IMDG: International Maritime Code for Dangerous Goods DOT: US Department of Transportation IATA: International Air Transport Association GHS: Globally Harmonised System of Classification and Labelling of Chemicals ACGIH: American Conference of Governmental Industrial Hygienists EINECS: European Inventory of Existing Commercial Chemical Substances ELINCS: European List of Notified Chemical Substances CAS: Chemical Abstracts Service (division of the American Chemical Society) NFPA: National Fire Protection Association (USA) According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 18/18 Safety Data Sheet Disclaimer Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, the information contained herein, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. The information contained herein is provided for reference purposes only and is HMIS: Hazardous Materials Identification System (USA) WHMIS: Workplace Hazardous Materials Information System (Canada) DNEL: Derived No-Effect Level (REACH) PNEC: Predicted No-Effect Concentration (REACH) LC50: Lethal concentration, 50 percent LD50: Lethal dose, 50 percent Expl. 1.1: Explosives, Division 1.1 Expl. 1.4: Explosives, Division 1.4 Unst. Expl.: Explosives, Unstable explosives Flam. Sol. 2: Flammable solids, Hazard Category 2 Pyr. Sol. 1: Pyorphoric Solids, Hazard Category 1 Water-react. 2: Substances and Mixtures which, in contact with water, emit flammable gases, Hazard Category 2 Ox. Sol. 1: Oxidising Solids, Hazard Category 1 Acute Tox. 3: Acute toxicity, Hazard Category 3 Acute Tox. 4: Acute toxicity, Hazard Category 4 Skin Irrit. 2: Skin corrosion/irritation, Hazard Category 2 Eye Irrit. 2: Serious eye damage/eye irritation, Hazard Category 2 Skin Sens. 1: Sensitisation - Skin, Hazard Category 1 Carc. 1A: Carcinogenicity, Hazard Category 1A Carc. 1B: Carcinogenicity, Hazard Category 1B Repr. 1A: Reproductive toxicity, Hazard Category 1A Repr. 1A: Reproductive toxicity, Hazard Category 1A STOT RE 1: Specific target organ toxicity - Repeated exposure, Hazard Category 1 STOT RE 2: Specific target organ toxicity - Repeated exposure, Hazard Category 2 Aquatic Acute 1: Hazardous to the aquatic environment - AcuteHazard, Category 1 Aquatic Chronic 1: Hazardous to the aquatic environment - Chronic Hazard, Category 1 Aquatic Chronic 4: Hazardous to the aquatic environment - Chronic Hazard, Category 4 Sources SDS Prepared by: ChemTel Inc. 1305 North Florida Avenue Tampa, Florida USA 33602-2902 Toll Free North America 1-888-255-3924 Intl. +01 813-248-0573 Website: www.chemtelinc.com Party Responsible for the Preparation of this Document Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 19/18 Safety Data Sheet intended only for persons having relevant technical skills. Because conditions and manner of use are outside of our control, the user is responsible for determining the conditions of safe use of the product. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product or information. Under no circumstances shall either Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. Product Disclaimer: Please see reverse side. TECHNICAL DATA SHEET NONEL® EZTL™ Nonelectric Trunkline Delay Detonators Properties SDS #1122 PRODUCT DESCRIPTION NONEL nonelectric delay detonator EZTL units consist of a length of yellow shock tube, with a surface detonator attached to one end and the other end sealed. The detonator is housed in a plastic EZ Connector block which facilitates easy connection to shock tube. A white J-hook is affixed near the sealed end. Easy- to-read, color-coded delay tags display the delay number and nominal firing time prominently. EZTL detonators are designed for use with NONEL MS and EZ DET® units to provide effective and accurate surface timing between blast holes and/or rows of blast holes in surface and underground blasting designs. APPLICATION RECOMMENDATIONS • For detailed application recommendations, ALWAYS request a copy of Dyno Nobel’s Product Manual: NONEL® and PRIMACORD® from your Dyno Nobel representative. • ALWAYS be sure that the shock tube(s) are securely inserted, one at a time, into the plastic EZ connector. The head of the connector block should rise to accept the tube, and return to a closed position with an audible click • ALWAYS ensure that the individual shock tubes remain aligned side by side in the EZ connector channel and do not cross over one another during insertion. • ALWAYS protect the plastic EZ connector and all shock tube leads from impact or damage. Use care when placing blasting mats and cover material on top of the blasting circuit. The EZ connector contains a detonator and is subject to detonation caused by abuse such as impact. Shock tube which has been cut, ruptured or damaged may cause misfires Net Explosive Content per 100 units 0.0240 kg 0.0529 lbs Hazardous Shipping Description • Detonator assemblies nonelectric, 1.4B, UN 0361 PG II Delay Time msec Connector Block Color 9 Green 17 Yellow 25 Red 33 Green 42 White 67 Blue 100 Black 109 Black Product Disclaimer: Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product. Under no circumstances shall Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. TECHNICAL DATA SHEET ADDITIONAL INFORMATION – Visit dynonobel.com for Brochures and Case Studies related to this product. Properties Cont. Packaging Length Case Type Quantity / Casemeters feet 3.5 12 D* 90 620D* 75 930D* 60 12 40 D* 50 15 50 D* 45 18 60 D* 35 • Length rounded to nearest one-half meter. • Case weight varies by length & delay; see case label for exact weight. * Always shipped with 2 cases strapped together. Case dimension width doubles. Case Dimensions Detpak (D) 44 x 22 x 25 cm 17½ x 8¾ x 10 in APPLICATION RECOMMENDATIONS - continued • NEVER use NONEL EZTL detonators with detonating cord. The low strength surface detonator will not initiate detonating cord • NEVER attempt to disassemble the delay detonator from the EZ connector block or use the detonator without the connector • NEVER place more than 6 shock tube leads into an EZ connector block, misfires may result • NEVER tie-in NONEL EZTL units to the blast initiation system until all blasthole surface connections have been made and inspected. Ensure the blast site has been cleared. It is important to remove nonessential personnel and equipment prior to the hole-to- hole connection process. Dyno Nobel Field Technical Representatives and product application guides can assist with unique connection situations. TRANSPORTATION, STORAGE AND HANDLING • NONEL EZTL must be transported, stored, handled and used in conformity with all federal, state, provincial and local laws and regulation • For maximum shelf life (3 years), NONEL EZTL must be stored in a cool, dry, well ventilated magazine. Explosive inventory should be rotated. Avoid using new materials before the old. For recommended good practices in transporting, storing, handling and using this product, see the booklet “Prevention of Accidents in the Use of Explosive Materials” packed inside each case and the Safety Library Publications of the Institute of Makers of Explosives NONEL® EZTL™ Nonelectric Trunkline Delay Detonators According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 1/18 Safety Data Sheet SECTION 1: IDENTIFICATION OF THE SUBSTANCE/MIXTURE AND OF THE COMPANY/UNDERTAKING Details of the supplier of the Safety Data Sheet Manufacturer/Supplier: Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 Fax: 801-321-6703 E-Mail: dnna.hse@am.dynonobel.com SDS #:1122 Date:07/20/2020 Supersedes: 05/22/2015 Product identifier Trade name: NONEL® Non-electric Delay Detonators Article number:1122 Other product identifiers: NONEL® MS NONEL® EZ DET® NONEL® MS ARCTIC NONEL®EZTL™ NONEL® LP NONEL® EZ DRIFTER® NONEL® SL NONEL® SUPER NONEL® TD NONEL® MS CONNECTOR NONEL® TWINPLEX™ NONEL® STARTER Relevant identified uses of the substance or mixture and uses advised against No further relevant information available. Application of the substance / the mixture Explosive product. Commercial blasting applications Emergency telephone number: CHEMTREC 1-800-424-9300 (US/Canada) +01 703-527-3887 (International) SECTION 2: HAZARDS IDENTIFICATION Classification of the substance or mixture Classification according to Regulation (EC) No 1272/2008 Classifications listed also are applicable to the OSHA GHS Hazard Communication Standard (29CFR1910.1200). exploding bomb Expl. 1.4 H204 Fire or projection hazard. Classification according to Directive 67/548/EEC or Directive 1999/45/EC R5: Heating may cause an explosion. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 2/18 Safety Data Sheet Information concerning particular hazards for human and environment:The product has to be labelled due to the calculation procedure of the "General Classification guideline for preparations of the EU" in the latest valid version. Classification system:The classification is according to the latest editions of the EU-lists, and extended by company and literature data. The classification is in accordance with the latest editions of international substances lists, and is supplemented by information from technical literature and by information provided by the company. Additional information:There are no other hazards not otherwise classified that have been identified. 0 percent of the mixture consists of component(s) of unknown toxicity Label elements Labelling according to Regulation (EC) No 1272/2008 The product is additionally classified and labelled according to the Globally Harmonized System within the United States (GHS). The product is classified and labelled according to the CLP regulation. Hazard pictograms GHS01 Signal word:Warning Hazard-determining components of labelling:diazodinitro phenol (DDNP) pentaerythritol tetranitrate (PETN) octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) lead diazide orange lead Hazard statements:H204 Fire or projection hazard. Precautionary statements: P210 Keep away from heat/sparks/open flames/hot surfaces. - No smoking. P250 Do not subject to grinding/shock/friction. P280 Wear protective gloves/protective clothing/eye protection/face protection. P240 Ground/bond container and receiving equipment. P373 DO NOT fight fire when fire reaches explosives. P370+P380 In case of fire: Evacuate area. P372 Explosion risk in case of fire. P401 Store in accordance with local/regional/national/international regulations. P501 Dispose of contents/container in accordance with local/regional/national/international regulations. Additional information:EUH201 Contains lead. Should not be used on surfaces liable to be chewed or sucked by children. Hazard description: WHMIS-symbols:Explosive products are not classified under WHMIS. NFPA ratings (scale 0 - 4):Not available. HMIS-ratings (scale 0 - 4):Not available. HMIS Long Term Health Hazard Substances 13424-46-9 lead diazide 7439-92-1 lead 13463-67-7 titanium dioxide 7758-97-6 lead chromate 7778-74-7 potassium perchlorate According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 3/18 Safety Data Sheet Other hazards Results of PBT and vPvB assessment PBT:Not applicable. vPvB:Not applicable. Explosive Product Notice:PREVENTION OF ACCIDENTS IN THE USE OF EXPLOSIVES - The prevention of accidents in the use of explosives is a result of careful planning and observance of the best known practices. The explosives user must remember that he is dealing with a powerful force and that various devices and methods have been developed to assist him in directing this force. He should realize that this force, if misdirected, may either kill or injure both him and his fellow workers. WARNING - All explosives are dangerous and must be carefully handled and used following approved safety procedures either by or under the direction of competent, experienced persons in accordance with all applicable federal, state, and local laws, regulations, or ordinances. If you have any questions or doubts as to how to use any explosive product, DO NOT USE IT before consulting with your supervisor, or the manufacturer, if you do not have a supervisor. If your supervisor has any questions or doubts, he should consult the manufacturer before use. SECTION 3: COMPOSITION/INFORMATION ON INGREDIENTS Mixtures Description:Mixture of substances listed below with nonhazardous additions. Dangerous components: CAS: 78-11-5 EINECS: 201-084-3 Index number: 603-035-00-5 pentaerythritol tetranitrate (PETN) E R3 Unst. Expl., H200 CAS: 13424-46-9 EINECS: 236-542-1 Index number: 082-003-00-7 lead diazide T Repr. Cat. 1, 3 R61; Xn R62-20/22; E R3; N R50/53 R33 Unst. Expl., H200 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 7439-92-1 EINECS: 231-100-4 lead T Repr. Cat. 1 R60-61-48/23/25; N R50/53 Repr. 1A, H360FD; STOT RE 1, H372 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 CAS: 7440-21-3 EINECS: 231-130-8 silicon F R11 Flam. Sol. 2, H228 CAS: 2691-41-0 EINECS: 220-260-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) T R24; Xn R22; E R2 Expl. 1.1, H201 Acute Tox. 3, H301; Acute Tox. 3, H311 CAS: 7782-49-2 EINECS: 231-957-4 Index number: 034-001-00-2 selenium T R23/25 R33-53 Acute Tox. 3, H301; Acute Tox. 3, H331 STOT RE 2, H373 Aquatic Chronic 4, H413 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 4/18 Safety Data Sheet CAS: 1314-41-6 EINECS: 215-235-6 Index number: 082-001-00-6 orange lead T Repr. Cat. 1, 3 R61;Xn R62-20/22;N R50/53 R33 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 10294-40-3 EINECS: 233-660-5 Index number: 056-002-00-7 barium chromate Xn R20/22 Carc. 1A, H350 Acute Tox. 4, H302; Acute Tox. 4, H332 CAS: 7758-97-6 EINECS: 231-846-0 Index number: 082-004-00-2 lead chromate T Carc. Cat. 2, Repr. Cat. 1, 3 R45-61; Xn R62;N R50/53 R33 Carc. 1B, H350; Repr. 1A, H360Df; STOT RE 2, H373 Aquatic Acute 1, H400; Aquatic Chronic 1, H410 CAS: 4682-03-5 diazodinitro phenol (DDNP) Xi R36/38;Xi R43; E R3 Unst. Expl., H200 Skin Irrit. 2, H315; Eye Irrit. 2, H319; Skin Sens. 1, H317 CAS: 7440-36-0 EINECS: 231-146-5 antimony substance with a Community workplace exposure limit CAS: 7440-33-7 EINECS: 231-143-9 tungsten substance with a Community workplace exposure limit CAS: 7429-90-5 EINECS: 231-072-3 Index number: 013-001-00-6 aluminium powder (pyrophoric) F R15-17 Pyr. Sol. 1, H250; Water-react. 2, H261 CAS: 7439-98-7 EINECS: 231-107-2 molybdenum substance with a Community workplace exposure limit CAS: 61790-53-2 Diatomaceous earth (Silica-Amorphous) substance with a Community workplace exposure limit CAS: 7778-74-7 EINECS: 231-912-9 Index number: 017-008-00-5 potassium perchlorate Xn R22; O R9 Ox. Sol. 1, H271 Acute Tox. 4, H302 CAS: 7727-43-7 EINECS: 231-784-4 barium sulphate, natural substance with a Community workplace exposure limit SVHC 13424-46-9 lead diazide 1314-41-6 orange lead 7758-97-6 lead chromate Additional information:For the wording of the listed risk phrases refer to section 16. For the listed ingredients, the identity and exact percentages are being withheld as a trade secret. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 5/18 Safety Data Sheet SECTION 4:FIRST AID MEASURES Description of first aid measures General information:No special measures required. After inhalation:Unlikely route of exposure. Supply fresh air; consult doctor in case of complaints. After skin contact:Generally the product does not irritate the skin. Wash with soap and water. If skin irritation is experienced, consult a doctor. After eye contact:Remove contact lenses if worn. Rinse opened eye for several minutes under running water. If symptoms persist, consult a doctor. After swallowing:Unlikely route of exposure. Do not induce vomiting; call for medical help immediately. Most important symptoms and effects, both acute and delayed Blast injury if mishandled. Hazards Danger of blast or crush-type injuries. Indication of any immediate medical attention and special treatment needed Product may produce physical injury if mishandled. Treatment of these injuries should be based on the blast and compression effects. SECTION 5: FIREFIGHTING MEASURES Extinguishing media Suitable extinguishing agents:DO NOT fight fire when fire reaches explosives. For safety reasons unsuitable extinguishing agents: None. Special hazards arising from the substance or mixture DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Can explode or detonate under fire conditions. Burning material may produce toxic vapors. It is recommended that users of explosives material be familiar with the Institute of Makers of Explosives Safety Library publications. Fire or projection hazard. Product may explode if burned in confined space. Individual cartridges may explode. Mass explosion of many cartridges at once is unlikely. Advice for firefighters Protective equipment:Wear self-contained respiratory protective device. Wear fully protective suit. Additional information Eliminate all ignition sources if safe to do so. Flammability Classification: (defined by 29 CFR 1910.1200) Explosive. Can explode under fire conditions. Individual devices will randomly explode. Will not mass explode if multiple devices are involved. Burning material may produce toxic and irritating vapors. In unusual cases, shrapnel may be thrown from exploding devices under containment. See 2008 Emergency response Guidebook for further information. SECTION 6: ACCIDENTAL RELEASE MEASURES Personal precautions, protective equipment and emergency procedures Wear protective clothing. Ensure adequate ventilation Protect from heat. Environmental precautions: Do not allow to enter sewers/ surface or ground water. Inform respective authorities in case of seepage into water course or sewage system. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 6/18 Safety Data Sheet Methods and material for containment and cleaning up: Pick up mechanically. Send for recovery or disposal in suitable receptacles. Dispose unusable material as waste according to item 13. Reference to other sections See Section 7 for information on safe handling. See Section 8 for information on personal protection equipment. See Section 13 for disposal information. SECTION 7: HANDLING AND STORAGE Precautions for safe handling Handle with care. Avoid jolting, friction and impact. Use only in well ventilated areas. Do not subject to grinding/shock/friction. Information about fire - and explosion protection:Protect from heat. Emergency cooling must be available in case of nearby fire. Conditions for safe storage, including any incompatibilities Storage: Requirements to be met by storerooms and receptacles:Store in a cool location. Avoid storage near extreme heat, ignition sources or open flame. Information about storage in one common storage facility:Store away from foodstuffs. Further information about storage conditions:Store in cool, dry conditions in well sealed receptacles. Keep away from heat. Specific end use(s)No further relevant information available. SECTION 8: EXPOSURE CONTROLS/PERSONAL PROTECTION Additional information about design of technical facilities: No further data; see item 7. Control parameters Ingredients with limit values that require monitoring at the workplace: 13424-46-9 lead diazide PEL (USA)Long-term value: 0,05 mg/m³ as Pb; See 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ as Pb;*8-hr TWA; See Pocket Guide App. C TLV (USA)Long-term value: 0,05 mg/m³ as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ as Pb; IARC 2A, R 7439-92-1 lead PEL (USA)Long-term value: 0,05* mg/m³ *see 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ *8-hr TWA,excl. lead arsenate; See PocketGuideApp.C TLV (USA)Long-term value: 0,05* mg/m³ *and inorganic compounds, as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ R; IARC 2B According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 7/18 Safety Data Sheet EV (Canada)Long-term value: 0,05 mg/m³ as Pb, Skin (organic compounds) 7440-21-3 silicon PEL (USA)Long-term value: 15* 5** mg/m³ *total dust **respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ *total dust **respirable fraction TLV (USA)TLV withdrawn EL (Canada)Long-term value: 10* 3** mg/m³ *total dust;**respirable fraction EV (Canada)Long-term value: 10 mg/m³ total dust 7782-49-2 selenium PEL (USA)Long-term value: 0,2 mg/m³ as Se REL (USA)Long-term value: 0,2 mg/m³ as Se TLV (USA)Long-term value: 0,2 mg/m³ as Se EL (Canada)Long-term value: 0,1 mg/m³ EV (Canada)Long-term value: 0,2 mg/m³ 1314-41-6 orange lead PEL (USA)Long-term value: 0,05 mg/m³ as Pb; See 29 CFR 1910,1025 REL (USA)Long-term value: 0,05* mg/m³ as Pb;*8-hr TWA; See Pocket Guide App. C TLV (USA)Long-term value: 0,05 mg/m³ as Pb; BEI EL (Canada)Long-term value: 0,05 mg/m³ as Pb; IARC 2A, R EV (Canada)Long-term value: 0,05 mg/m³ as Pb, Skin (organic compounds) 13463-67-7 titanium dioxide PEL (USA)Long-term value: 15* mg/m³ *total dust REL (USA)See Pocket Guide App. A TLV (USA)Long-term value: 10 mg/m³ withdrawn from NIC EL (Canada)Long-term value: 10* 3** mg/m³ *total dust;**respirable fraction; IARC 2B EV (Canada)Long-term value: 10 mg/m³ total dust 10294-40-3 barium chromate PEL (USA)Long-term value: 0,005* mg/m³ Ceiling limit: 0,1** mg/m³ *as Cr(VI) **as CrO3; see 29 CFR 1910,1026 REL (USA)Long-term value: 0,0002 mg/m³ as Cr; See Pocket Guide Apps. A and C TLV (USA)Long-term value: 0,01 mg/m³ as Cr According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 8/18 Safety Data Sheet EL (Canada)Long-term value: 0,01 mg/m³ as Cr; ACGIH A1 IARC 1 7758-97-6 lead chromate IOELV (EU)Long-term value: 2 mg/m³ as Cr PEL (USA)Long-term value: 0,005* mg/m³ Ceiling limit: 0,1** mg/m³ *as Cr(VI) **as CrO3; see 29 CFR 1910,1026 REL (USA)Long-term value: 0,0002 mg/m³ as Cr; See Pocket Guide Apps. A and C TLV (USA)Long-term value: 0,05* 0,012** mg/m³ *as Pb; BEI ; **as Cr EL (Canada)Long-term value: 0,05* 0,012** mg/m³ ACIGH A2, IARC 2A; R; *as Pb;**as Cr EV (Canada)Long-term value: 0,012* 0,05** mg/m³ *as Cr, **as Pb 7727-43-7 barium sulphate, natural PEL (USA)Long-term value: 15* 5** mg/m³ *total dust **respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ *total dust **respirable fraction TLV (USA)Long-term value: 5* mg/m³ *inhalable fraction; E EL (Canada)Long-term value: 10* 3** mg/m³ *total dust, **respirable fraction EV (Canada)Long-term value: 10 mg/m³ total dust 61790-53-2 Diatomaceous earth (Silica-Amorphous) PEL (USA)20mppcf or 80mg/m3 /%SiO2 REL (USA)Long-term value: 6 mg/m³ See Pocket Guide App. C TLV (USA)TLV withdrawn EL (Canada)Long-term value: 4* 1,5** mg/m³ *total, **respirable EV (Canada)Long-term value: 10* 3** mg/m³ uncalcined; *inhalable;**respirable 7439-98-7 molybdenum PEL (USA)Long-term value: 15* mg/m³ *Total dust TLV (USA)Long-term value: 10* 3** mg/m³ as Mo; *inhalable fraction ** respirable fraction EL (Canada)Long-term value: 3* 10** mg/m³ as Mo; *respirable **inhalable EV (Canada)Long-term value: 10* 3** 0,5*** mg/m³ metal,insol.compd.:*inh;**resp;sol.compd.:***resp 7440-33-7 tungsten PEL (USA)and insoluble compounds, as We REL (USA)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 9/18 Safety Data Sheet TLV (USA)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W EL (Canada)Short-term value: 10 mg/m³ Long-term value: 5 mg/m³ as W EV (Canada)Short-term value: 10* 3** mg/m³ Long-term value: 5* 1** mg/m³ (as tungsten; compds.:*water-insol.;**water-sol. 7429-90-5 aluminium powder (pyrophoric) PEL (USA)Long-term value: 15*; 15** mg/m³ *Total dust; ** Respirable fraction REL (USA)Long-term value: 10* 5** mg/m³ as Al*Total dust**Respirable/pyro powd./welding f. TLV (USA)Long-term value: 1* mg/m³ as Al; *as respirable fraction EL (Canada)Long-term value: 1,0 mg/m³ respirable, as Al EV (Canada)Long-term value: 5 mg/m³ aluminium-containing (as aluminium) 7440-36-0 antimony PEL (USA)Long-term value: 0,5 mg/m³ as Sb REL (USA)Long-term value: 0,5 mg/m³ as Sb TLV (USA)Long-term value: 0,5 mg/m³ as Sb EL (Canada)Long-term value: 0,5 mg/m³ EV (Canada)Long-term value: 0,5 mg/m³ DNELs No further relevant information available. PNECs No further relevant information available. Ingredients with biological limit values: 13424-46-9 lead diazide BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 7439-92-1 lead BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10 μg/100 ml Medium: blood Time: not critical According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 10/18 Safety Data Sheet Parameter: Lead (women of child bearing potential) 1314-41-6 orange lead BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10294-40-3 barium chromate BEI (USA)25 μg/L Medium: urine Time: end of shift at end of workweek Parameter: Total chromium (fume) 10 μg/L Medium: urine Time: increase during shift Parameter: Total chromium (fume) 7758-97-6 lead chromate BEI (USA)30 μg/100 ml Medium: blood Time: not critical Parameter: Lead 10 μg/100 ml Medium: blood Time: not critical Parameter: Lead (women of child bearing potential) Additional information:The lists valid during the making were used as basis. Exposure controls Personal protective equipment: General protective and hygienic measures: The usual precautionary measures are to be adhered to when handling chemicals. Keep ignition sources away - Do not smoke. Keep away from foodstuffs, beverages and feed. Wash hands before breaks and at the end of work. Respiratory protection: Not required under normal conditions of use. Respiratory protection may be required after product use. Protection of hands: Wear gloves for the protection against mechanical hazards according to NIOSH or EN 388. Material of gloves: The selection of the suitable gloves does not only depend on the material, but also on further marks of quality and varies from manufacturer to manufacturer. As the product is a preparation of several substances, the resistance of According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 11/18 Safety Data Sheet SECTION 9: PHYSICAL AND CHEMICAL PROPERTIES Information on basic physical and chemical properties General Information Appearance: Form:Solid material Colour:According to product specification Odour:Odourless Odour threshold:Not determined. pH-value:Not applicable. Change in condition Melting point/Melting range:Not determined. Boiling point/Boiling range:Undetermined. Flash point:Not applicable. Flammability (solid, gaseous):Fire or projection hazard. Auto/Self-ignition temperature:Not determined. Decomposition temperature:Not determined. Self-igniting:Product is not self-igniting. Danger of explosion:Heating may cause an explosion. Explosion limits: Lower:Not determined. Upper:Not determined. Vapour pressure:Not applicable. Density:Not determined. Relative density Not determined. Vapour density Not applicable. Evaporation rate Not applicable. Solubility in / Miscibility with water:Variable, dependent upon product composition and packaging. Partition coefficient (n-octanol/water):Not determined. Viscosity: Dynamic:Not applicable. Kinematic:Not applicable. Other information No further relevant information available. the glove material can not be calculated in advance and has therefore to be checked prior to the application. Penetration time of glove material: The exact break through time has to be found out by the manufacturer of the protective gloves and has to be observed. Eye protection: Face protection Safety glasses Body protection: Impervious protective clothing Limitation and supervision of exposure into the environment: No further relevant information available. Risk management measures: Organizational measures should be in place for all activities involving this product. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 12/18 Safety Data Sheet SECTION 10: STABILITY AND REACTIVITY Reactivity Chemical stability Thermal decomposition / conditions to be avoided:No decomposition if used and stored according to specifications. Keep away from heat/sparks/open flames/hot surfaces. - No smoking. Possibility of hazardous reactions Danger of explosion. Toxic fumes may be released if heated above the decomposition point. Reacts violently with oxidising agents. Conditions to avoid Keep ignition sources away - Do not smoke. Incompatible materials: No further relevant information available. Hazardous decomposition products: Carbon monoxide and carbon dioxide Hydrocarbons Leadoxide vapour Bariumoxide vapour Toxic metal oxide smoke Chlorine compounds Danger of forming toxic pyrolysis products. Nitrogen oxides SECTION 11: TOXICOLOGICAL INFORMATION Information on toxicological effects Acute toxicity: LD/LC50 values relevant for classification: 7439-92-1 lead Oral LD50 >2000 mg/kg (rat) 7782-49-2 selenium Oral LD50 6700 mg/kg (rat) 7758-97-6 lead chromate Oral LD50 12000 mg/kg (mouse) Primary irritant effect: on the skin:Not a skin irritant in unused form. Vapors/particles from used product are possibly irritating to skin. on the eye:Not an eye irritant in unused form. Vapors/particles from used product are possibly irritating to eyes. Sensitisation:No sensitising effects known. Subacute to chronic toxicity:No further relevant information available. Acute effects (acute toxicity, irritation and corrosivity):Danger of blast or crush-type injuries. Repeated dose toxicity:Contains known or suspect carcinogens when inhaled. Product is in non-inhalable form and is nonclassifiable as a carcinogen. CMR effects (carcinogenity, mutagenicity and toxicity for reproduction):Contains known or suspect carcinogens when inhaled. Product is in non-inhalable form and is non- classifiable as a carcinogen. SECTION 12: ECOLOGICAL INFORMATION Toxicity Aquatic toxicity:Toxic for aquatic organisms Persistence and degradability:No further relevant information available. Bioaccumulative potential:May be accumulated in organism Mobility in soil:No further relevant information available. Ecotoxical effects: Remark: Toxic for fish According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 13/18 Safety Data Sheet Additional ecological information: General notes:Water hazard class 3 (German Regulation) (Self-assessment): extremely hazardous for water Do not allow product to reach ground water, water course or sewage system, even in small quantities. Danger to drinking water if even extremely small quantities leak into the ground. Also poisonous for fish and plankton in water bodies. The product contains heavy metals. Avoid transfer into the environment. Specific preliminary treatments are necessary Toxic for aquatic organisms Due to available data on eliminability/decomposition and bioaccumulation potential prolonged term damage of the environment can not be excluded. Results of PBT and vPvB assessment PBT:Not applicable. vPvB: Not applicable. Other adverse effects:No further relevant information available. SECTION 13: DISPOSAL CONSIDERATIONS Waste treatment methods: Recommendation: Must not be disposed together with household garbage. Do not allow product to reach sewage system. Damaged materials pose a danger to anyone in the immediate area; consult experts for disposal of damaged products. The user of this material has the responsibility to dispose of unused material, residues and containers in compliance with all relevant local, state and federal laws and regulations regarding treatment, storage and disposal for hazardous and nonhazardous wastes. Residual materials should be treated as hazardous. Uncleaned packaging: Recommendation:Disposal must be made according to official regulations. SECTION 14: TRANSPORT INFORMATION UN-Number DOT, ADR, IMDG, IATA UN0361 UN proper shipping name DOT Detonator assemblies, non-electric ADR 0361 DETONATOR ASSEMBLIES, NONELECTRIC, IMDG DETONATOR ASSEMBLIES, NONELECTRIC, IATA DETONATOR ASSEMBLIES, NON-ELECTRIC Transport hazard class(es) DOT, ADR, IMDG, IATA Class Label 1.4 1.4B Packing group DOT, ADR, IMDG, IATA II Environmental hazards: Marine pollutant:No According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 14/18 Safety Data Sheet Special marking (IATA): Cargo Aircraft Only. Prohibited from Transport in Passenger Aircraft. Special precautions for user Not applicable. EMS Number: Segregation groups F-B, S-X Lead and its compounds Transport in bulk according to Annex II of MARPOL73/78 and the IBC Code Transport/Additional information: Not applicable. ADR Limited quantities (LQ)0 Excepted quantities (EQ)Code: EO Tunnel restriction code 2 (E) IMDG Limited quantities (LQ)0 Excepted quantities (EQ)Code: EO UN “Model Regulation”:UN 0361, DETONATOR ASSEMBLIES, NONELECTRIC, 1.4B, II SECTION 15: REGULATORY INFORMATION Safety, health and environmental regulations/legislation specific for the substance or mixture United States (USA) SARA Section 355 (extremely hazardous substances): None of the ingredients are listed. Section 313 (Specific toxic chemical listings): 13424-46-9 lead diazide 7439-92-1 lead 7782-49-2 selenium 1314-41-6 orange lead 10294-40-3 barium chromate 7758-97-6 lead chromate 7727-43-7 barium sulphate, natural 7429-90-5 aluminium powder (pyrophoric) 7440-36-0 antimony TSCA (Toxic Substances Control Act): All ingredients are listed. Proposition 65 (California): Chemicals known to cause cancer: 13424-46-9 lead diazide 7439-92-1 lead 1314-41-6 orange lead According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 15/18 Safety Data Sheet 13463-67-7 titanium dioxide 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause reproductive toxicity for females: 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause reproductive toxicity for males: 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Chemicals known to cause developmental toxicity: 13424-46-9 lead diazide 7439-92-1 lead 10294-40-3 barium chromate 7758-97-6 lead chromate Carcinogenic Categories EPA (Environmental Protection Agency) 13424-46-9 lead diazide B2 7439-92-1 lead B2 7782-49-2 selenium D 1314-41-6 orange lead B2 10294-40-3 barium chromate A(inh), D(oral), K/L(inh), CBD(oral) 7758-97-6 lead chromate K 7727-43-7 barium sulphate, natural D, CBD(inh), NL(oral) 7778-74-7 potassium perchlorate NL 2691-41-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX)D IARC (International Agency for Research on Cancer) 13424-46-9 lead diazide 2A 7439-92-1 lead 2B 7782-49-2 selenium 3 1314-41-6 orange lead 2A 13463-67-7 titanium dioxide 2B 10294-40-3 barium chromate 1 7758-97-6 lead chromate 1 61790-53-2 Diatomaceous earth (Silica-Amorphous)3 TLV (Threshold Limit Value established by ACGIH) 13424-46-9 lead diazide A3 7439-92-1 lead A3 1314-41-6 orange lead A3 13463-67-7 titanium dioxide A4 10294-40-3 barium chromate A1 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 16/18 Safety Data Sheet 7758-97-6 lead chromate A2 7439-98-7 molybdenum A3 7429-90-5 aluminium powder (pyrophoric)A4 NIOSH-Ca (National Institute for Occupational Safety and Health) 13463-67-7 titanium dioxide 10294-40-3 barium chromate 7758-97-6 lead chromate Canada Canadian Domestic Substances List (DSL) Some components are listed on the NDSL. All ingredients are listed. Canadian Ingredient Disclosure list (limit 0.1%) 7439-92-1 lead 7782-49-2 selenium 10294-40-3 barium chromate 7758-97-6 lead chromate Canadian Ingredient Disclosure list (limit 1%) 7439-98-7 molybdenum 7440-33-7 tungsten 7429-90-5 aluminium powder (pyrophoric) 7440-36-0 antimony Other regulations, limitations and prohibitive regulations Thisproducthasbeenclassifiedin accordancewithhazardcriteriaof theControlledProducts Regulations and the SDS contains all the information required by the Controlled Products Regulations. Substances of very high concern (SVHC) according to REACH, Article 57 13424-46-9 lead diazide 1314-41-6 orange lead 7758-97-6 lead chromate Chemical safety assessment: A Chemical Safety Assessment has not been carried out. SECTION 16: OTHER INFORMATION Relevant phrases H200 Unstable explosives. H201 Explosive; mass explosion hazard. H228 Flammable solid. H250 Catches fire spontaneously if exposed to air. H261 In contact with water releases flammable gases. H271 May cause fire or explosion; strong oxidiser. H301 Toxic if swallowed. H302 Harmful if swallowed. H311 Toxic in contact with skin. H315 Causes skin irritation. H317 May cause an allergic skin reaction. H319 Causes serious eye irritation. According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 17/18 Safety Data Sheet H331 Toxic if inhaled. H332 Harmful if inhaled. H350 May cause cancer. H360Df May damage the unborn child. Suspected of damaging fertility. H360FD May damage fertility. May damage the unborn child. H372 Causes damage to organs through prolonged or repeated exposure. H373 May cause damage to organs through prolonged or repeated exposure. H400 Very toxic to aquatic life. H410 Very toxic to aquatic life with long lasting effects. H413 May cause long lasting harmful effects to aquatic life. R11 Highly flammable. R15 Contact with water liberates extremely flammable gases. R17 Spontaneously flammable in air. R2 Risk of explosion by shock, friction, fire or other sources of ignition. R20/22 Harmful by inhalation and if swallowed. R22 Harmful if swallowed. R23/25 Toxic by inhalation and if swallowed. R24 Toxic in contact with skin. R3 Extreme risk of explosion by shock, friction, fire or other sources of ignition. R33 Danger of cumulative effects. R36/38 Irritating to eyes and skin. R43 May cause sensitisation by skin contact. R45 May cause cancer. R48/23/25 Toxic: danger of serious damage to health by prolonged exposure through inhalation and if swallowed. R50/53 Very toxic to aquatic organisms, may cause long-term adverse effects in the aquatic environment. R53 May cause long-term adverse effects in the aquatic environment. R60 May impair fertility. R61 May cause harm to the unborn child. R62 Possible risk of impaired fertility. R9 Explosive when mixed with combustible material. Abbreviations and acronyms: ADR: Accord européen sur le transport des marchandises dangereuses par Route (European Agreement concerning the International Carriage of Dangerous Goods by Road) IMDG: International Maritime Code for Dangerous Goods DOT: US Department of Transportation IATA: International Air Transport Association GHS: Globally Harmonised System of Classification and Labelling of Chemicals ACGIH: American Conference of Governmental Industrial Hygienists EINECS: European Inventory of Existing Commercial Chemical Substances ELINCS: European List of Notified Chemical Substances CAS: Chemical Abstracts Service (division of the American Chemical Society) NFPA: National Fire Protection Association (USA) According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 18/18 Safety Data Sheet Disclaimer Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, the information contained herein, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. The information contained herein is provided for reference purposes only and is HMIS: Hazardous Materials Identification System (USA) WHMIS: Workplace Hazardous Materials Information System (Canada) DNEL: Derived No-Effect Level (REACH) PNEC: Predicted No-Effect Concentration (REACH) LC50: Lethal concentration, 50 percent LD50: Lethal dose, 50 percent Expl. 1.1: Explosives, Division 1.1 Expl. 1.4: Explosives, Division 1.4 Unst. Expl.: Explosives, Unstable explosives Flam. Sol. 2: Flammable solids, Hazard Category 2 Pyr. Sol. 1: Pyorphoric Solids, Hazard Category 1 Water-react. 2: Substances and Mixtures which, in contact with water, emit flammable gases, Hazard Category 2 Ox. Sol. 1: Oxidising Solids, Hazard Category 1 Acute Tox. 3: Acute toxicity, Hazard Category 3 Acute Tox. 4: Acute toxicity, Hazard Category 4 Skin Irrit. 2: Skin corrosion/irritation, Hazard Category 2 Eye Irrit. 2: Serious eye damage/eye irritation, Hazard Category 2 Skin Sens. 1: Sensitisation - Skin, Hazard Category 1 Carc. 1A: Carcinogenicity, Hazard Category 1A Carc. 1B: Carcinogenicity, Hazard Category 1B Repr. 1A: Reproductive toxicity, Hazard Category 1A Repr. 1A: Reproductive toxicity, Hazard Category 1A STOT RE 1: Specific target organ toxicity - Repeated exposure, Hazard Category 1 STOT RE 2: Specific target organ toxicity - Repeated exposure, Hazard Category 2 Aquatic Acute 1: Hazardous to the aquatic environment - AcuteHazard, Category 1 Aquatic Chronic 1: Hazardous to the aquatic environment - Chronic Hazard, Category 1 Aquatic Chronic 4: Hazardous to the aquatic environment - Chronic Hazard, Category 4 Sources SDS Prepared by: ChemTel Inc. 1305 North Florida Avenue Tampa, Florida USA 33602-2902 Toll Free North America 1-888-255-3924 Intl. +01 813-248-0573 Website: www.chemtelinc.com Party Responsible for the Preparation of this Document Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 According to 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade name: NONEL® Non-electric Delay Detonators SDS# 1122 Date: 07/20/2020 Page 19/18 Safety Data Sheet intended only for persons having relevant technical skills. Because conditions and manner of use are outside of our control, the user is responsible for determining the conditions of safe use of the product. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product or information. Under no circumstances shall either Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. Product Disclaimer: Please see reverse side. TECHNICAL DATA SHEET NONEL® LEAD LINE Nonelectric Shock Tube Properties SDS #1124 Net Explosive Content per 100 units 0.0044 kg 0.0097 lbs Hazardous Shipping Description • Articles, Explosives, N.O.S. (HMX, Aluminum), 1.4S, UN 0349, PG II PRODUCT DESCRIPTION NONEL LEAD LINE is NONEL shock tube spooled at the factory in 763 meter (2,500 foot) lengths for easy application and deployment. NONEL LEAD LINE shock tube is a small diameter, three-layer plastic tube coated on the innermost wall with a reactive explosive compound. When initiated, NONEL shock tube propagates a low energy signal, similar to a dust explosion, at approximately 2000 m/ sec (6,500 ft/sec) along the tube’s length with minimal disturbance to the outside of the tube. The signal is transmitted from one NONEL shock tube to another through field- assembled splices. NONEL LEAD LINE provides maximum flexibility to the blaster in choosing a position of safety from which to initiate nonelectric blast rounds in either underground or surface applications. NONEL LEAD LINE is the only NONEL product that can be cut and spliced into a NONEL detonator product to construct a custom length nonelectric starter assembly. APPLICATION RECOMMENDATIONS • ALWAYS splice NONEL LEAD LINE to NONEL EZTL™ nonelectric trunkline delay detonators, NONEL EZ DET® nonelectric blast initiation system, NONEL TD or NONEL Starter detonators to make-up the nonelectric starter assembly when using NONEL LEAD LINE as the primary initiator for NONEL blast rounds. • ALWAYS trim at least 3 m [10 ft] of tubing before inserting into a nonelectric shock tube starting device or whenever dirt and/or moisture may have compromised the open tube ends before making a splice connection. Length Spools / Casemeters feet 762 2500 2 • Length rounded to nearest one-half meter. • See case label for exact case weight. Case Dimensions 51 x 25 x 28 cm 20 x 9 7/8 x 10 7/8 in Product Disclaimer: Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product. Under no circumstances shall Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. TECHNICAL DATA SHEET ADDITIONAL INFORMATION – Visit dynonobel.com for Brochures and Case Studies related to this product. APPLICATION RECOMMENDATIONS - continued • ALWAYSreplace the plastic tube closure over the open end of any NONEL LEAD LINE that remains on the spool and is intended to be used to make up another nonelectric starter assembly. • ALWAYSmake the final hook-up of the nonelectric starter assembly to the blast round only after all equipment and non-essential personnel are clear of the blast area. • ALWAYSunspool NONEL LEAD LINE by hand if the starter assembly has been spliced to it and is attached to the blast round. • ALWAYS keep any NONEL LEAD LINE tube ends sealed and free from dirt and moisture since dirt or moisture in the shock tube may cause a misfire. • NEVER use NONEL LEAD LINE for in-hole use. NONEL LEAD LINE is for use outside the borehole only. • NEVER attempt to knot different lengths of shock tube together. Shock tube will not initiate itself through knot connections. It must be spliced. • NEVER remove the plastic tube closure from the NONEL LEAD LINE shock tube until just before splicing. • NEVER attach the starter assembly to the blast round until after the LEAD LINE deployment is complete whenever NONEL LEAD LINE is to be unspooled by any method other than by hand, •NEVER run over NONEL LEAD LINE with equipment. This may damage the shock tube and may cause a misfire. • ALWAYS replace the NONEL LEAD LINE if it is damaged • When making a nonelectric starter assembly using NONEL LEAD LINE, ALWAYS remove the plastic tube closure and save for later use. Splice two freshly-cut ends of NONEL shock tube together (one from the NONEL LEAD LINE and the other from the NONEL detonator) by inserting them into opposite ends of the plastic connector sleeve and pushing them toward one another until they are both at least ½ cm (¼ in) in the splice. TRANSPORTATION, STORAGE AND HANDLING • NONEL LEAD LINE must be transported, stored, handled and used in conformity with all federal, state, provincial and local laws and regulations. • For maximum shelf life (3 years), NONEL LEAD LINE must be stored in a cool, dry, well ventilated magazine. Explosive inventory should be rotated. Avoid using new materials before the old. For recommended good practices in transporting, storing, handling and using this product, see the booklet “Prevention of Accidents in the Use of Explosive Materials” packed inside each case and the Safety Library Publications of the Institute of Makers of Explosives. NONEL® LEAD LINE Nonelectric Shock Tube According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 1 of 10 Safety Data Sheet SECTION 1 –IDENTIFICATION OF THE SUBSTANCE/MIXTURE AND OF THE COMPANY/UNDERTAKING Name, Address, and Telephone of the Responsible Party Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 Fax 801-321-6703 E-Mail: dnna.hse@am.dynonobel.com www.dynonobel.com SDS #:1124 Date:07/20/2020 Supersedes: 05/22/2015 1.1 Product Identifier Trade Name: Shock Tube Article Number:1124 Other Product Identifiers: NONEL®LEAD LINE 1.2 Relevant Identified uses of the Substance or Mixture and uses Advised Against No further relevant information available. Application of the Substance / the Mixture Explosive product. Commercial blasting applications. 1.3. Emergency Telephone Number CHEMTREC 1-800-424-9300 (US/Canada) +01 703-527-3887 (International) SECTION 2 –HAZARD(S) IDENTIFICATION 2.1 Classification of the Substance or Mixture Classification According to Regulation (EC) No 1272/2008 Classifications listed also are applicable to the OSHA GHS Hazard Communication Standard (29CFR1910.1200). exploding bomb Expl. 1.4 H204 Fire or projection hazard. Classification According to Directive 67/548/EEC or Directive 1999/45/EC R5: Heating may cause an explosion. Information Concerning Particular Hazards for Human and Environment:Not applicable. Additional Information:There are no other hazards not otherwise classified that have been identified. 0 percent of the mixture consists of component(s) of unknown toxicity 2.2 Label Elements Labelling According to Regulation (EC) No 1272/2008 The product is additionally classified and labelled according to the Globally Harmonized System within the United States (GHS). The product is classified and labelled according to the CLP regulation. Hazard Pictograms GHS01 According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 2 of 10 Safety Data Sheet Signal Word : Warning Hazard-determining components of labelling : octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) Hazard Statements : H204 Fire or projection hazard. Precautionary Statements : P210 - Keep away from heat/sparks/open flames/hot surfaces. - No smoking. P250 - Do not subject to grinding/shock/friction. P280 - Wear protective gloves/protective clothing/eye protection/face protection. P240 - Ground/bond container and receiving equipment. P373 - DO NOT fight fire when fire reaches explosives. P370+P380 - In case of fire: Evacuate area. P372 - Explosion risk in case of fire. P401 - Store in accordance with local/regional/national/international regulations. P501 - Dispose of contents/container in accordance with local/regional/national/international regulations. Hazard Description WHMIS-Symbols : Explosive products are not classified under WHMIS. NFPA Ratings (scale 0 - 4) : Not available. HMIS-Ratings (scale 0 - 4) : Not available. HMIS Long Term Health Hazard Substances None of the ingredients are listed. 2.3 Other Hazards Results of PBT and vPvB Assessment PBT : Not available. vPvB : Not available. Explosive Product Notice:PREVENTION OF ACCIDENTS IN THE USE OF EXPLOSIVES - The prevention of accidents in the use of explosives is a result of careful planning and observance of the best known practices. The explosives user must remember that he is dealing with a powerful force and that various devices and methods have been developed to assist him in directing this force. He should realize that this force, if misdirected, may either kill or injure both him and his fellow workers. WARNING - All explosives are dangerous and must be carefully handled and used following approved safety procedures either by or under the direction of competent, experienced persons in accordance with all applicable federal, state, and local laws, regulations, or ordinances. If you have any questions or doubts as to how to use any explosive product, DO NOT USE IT before consulting with your supervisor, or the manufacturer, if you do not have a supervisor. If your supervisor has any questions or doubts, he should consult the manufacturer before use. SECTION 3 –COMPOSITION/INFORMATION ON INGREDIENTS 3.1 Mixtures Description: Mixture of substances listed below with nonhazardous additions. Dangerous components: CAS: 2691-41-0 EINECS: 220-260-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX) T R24;Xn R22;E R2 Expl. 1.1, H201 Acute Tox. 3, H301; Acute Tox. 3, H311 CAS: 7429-90-5 EINECS: 231-072-3 Index number: 013-001-00-6 aluminium powder (pyrophoric) F R15-17 Pyr. Sol. 1, H250; Water-react. 2, H261 Additional Information: For the listed ingredients, the identity and exact percentages are being withheld as a trade secret. For the wording of the listed risk phrases refer to section 16. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 3 of 10 Safety Data Sheet SECTION 4 –FIRST AID MEASURES 4.1 Description of First Aid Measures General Information:No special measures required. After Inhalation:Unlikely route of exposure. Supply fresh air; consult doctor in case of complaints. After Skin Contact:Generally the product does not irritate the skin. Wash with soap and water. If skin irritation is experienced, consult a doctor. After Eye Contact:Remove contact lenses if worn. Rinse opened eye for several minutes under running water. If symptoms persist, consult a doctor. After Swallowing:Unlikely route of exposure. Do not induce vomiting; call for medical help immediately. 4.2 Most Important Symptoms and Effects, Both Acute and Delayed Blast injury if mishandled. Hazards Danger of blast or crush-type injuries. 4.3 Indication of Any Immediate Medical Attention and Special Treatment Needed Product may produce physical injury if mishandled. Treatment of these injuries should be based on the blast and compression effects. SECTION 5 –FIRE-FIGHTING MEASURES 5.1 Extinguishing Media Suitable Extinguishing Agents:DO NOT FIGHT FIRE WHEN FIRE REACHES EXPLOSIVES. For Safety Reasons Unsuitable Extinguishing Agents: None. 5.2 Special Hazards Arising from the Substance or Mixture DO NOT ATTEMPT TO FIGHT FIRES INVOLVING EXPLOSIVE MATERIALS. Evacuate all personnel to a predetermined safe location, no less than 2,500 feet in all directions. Can explode or detonate under fire conditions. Burning material may produce toxic vapors. It is recommended that users of explosives material be familiar with the Institute of Makers of Explosives Safety Library publications. Product may explode if burned in confined space. Individual cartridges may explode. Mass explosion of many cartridges at once is unlikely. 5.3 Advice for Firefighters Protective Equipment:Wear self-contained respiratory protective device. Wear fully protective suit. Additional Information Eliminate all ignition sources if safe to do so.Flammability Classification: (defined by 29 CFR 1910.1200) Explosive. Can explode under fire conditions. Individual devices will randomly explode. Will not mass explode if multiple devices are involved. Burning material may produce toxic and irritating vapors. In unusual cases, shrapnel may be thrown from exploding devices under containment. See 2008 Emergency response Guidebook for further information. SECTION 6 –ACCIDENTAL RELEASE MEASURES 6.1 Personal Precautions, Protective Equipment and Emergency Procedures Remove persons from danger area. Ensure adequate ventilation Wear protective clothing. Protect from heat. Evacuate area. Isolate area and prevent access. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 4 of 10 Safety Data Sheet 6.2 Environmental Precautions No special measures required. 6.3 Methods and Material for Containment and Cleaning Up Pick up mechanically. Send for recovery or disposal in suitable receptacles. Dispose unusable material as waste according to item 13. 6.4 Reference to Other Sections See Section 7 for information on safe handling. See Section 8 for information on personal protection equipment. See Section 13 for disposal information. SECTION 7 –HANDLING AND STORAGE 7.1 Precautions for Safe Handling Handle with care. Avoid jolting, friction and impact. Use only in well ventilated areas. Do not subject to grinding/shock/friction. Information About Fire - and Explosion Protection:Protect from heat. Emergency cooling must be available in case of nearby fire. 7.2 Conditions for Safe Storage, Including Any Incompatibilities Storage: Requirements to be Met by Storerooms and Receptacles:Store in a cool location. Avoid storage near extreme heat, ignition sources or open flame. Information About Storage in One Common Storage Facility:Store away from foodstuffs. Further Information About Storage Conditions:Store in cool, dry conditions in well sealed receptacles. Keep away from heat. 7.3 Specific End Use(s):No further relevant information available. SECTION 8 –EXPOSURE CONTROLS/PERSONAL PROTECTION Additional Information About Design of Technical Facilities:No further data; see item 7. 8.1 Control Parameters Ingredients with Limit Values that Require Monitoring at the Workplace:The product does not contain any relevant quantities of materials with critical values that have to be monitored at the workplace. DNELs:No further relevant information available. PNECs:No further relevant information available. Additional Information: The lists valid during the making were used as basis. 8.2 Exposure Controls Personal Protective Equipment: General Protective and Hygienic Measures:The usual precautionary measures are to be adhered to when handling chemicals. Keep away from foodstuffs, beverages and feed. Wash hands before breaks and at the end of work. Respiratory Protection:Not required under normal conditions of use. Respiratory protection may be required after product use. Protection of Hands:Wear gloves for the protection against mechanical hazards according to NIOSH or EN 388. Material of Gloves:The selection of the suitable gloves does not only depend on the material, but also on further marks of quality and varies from manufacturer to manufacturer. Penetration Time of Glove Material: The exact break through time has to be found out by the manufacturer of the protective gloves and has to be observed. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 5 of 10 Safety Data Sheet SECTION 9 –PHYSICAL AND CHEMICAL PROPERTIES 9.1 Information on Basic Physical and Chemical Properties General Information Appearance Form :Solid material Colour :According to product specification Odour :Odourless Odour Threshold :Not determined. pH- Value :Not applicable. Change in Condition Melting point/Melting range :Not Determined. Boiling point/Boiling range :Undetermined. Flash Point :Not applicable. Flammability (solid, gaseous):Fire or projection hazard. Auto/Self-ignition temperature :Not determined. Decomposition temperature :Not determined. Self-igniting :Not determined. Danger of explosion :Heating may cause an explosion. Explosion limits Lower :Not determined. Upper :Not determined. Vapour pressure :Not applicable. Density :Not determined. Relative density :Not determined. Vapour density :Not applicable. Evaporation rate :Not applicable. Solubility in / Miscibility with water :Variable, dependent upon product composition and packaging. Partition coefficient (n-octanol/water):Not determined. Viscosity Dynamic :Not applicable. Kinematic :Not applicable. 9.2 Other Information :No further relevant information available. Eye Protection: Safety glasses Face protection Body Protection: Protective work clothing Limitation and Supervision of Exposure into the Environment: No further relevant information available. Risk Management Measures: Organizational measures should be in place for all activities involving this product. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 6 of 10 Safety Data Sheet SECTION 10 –STABILITY AND REACTIVITY 10.1 Reactivity: 10.2 Chemical Stability: Thermal Decomposition / Conditions to be Avoided:Keep away from heat/sparks/open flames/hot surfaces. - No smoking. 10.3 Possibility of Hazardous Reactions: Danger of explosion. Toxic fumes may be released if heated above the decomposition point. 10.4 Conditions to Avoid:No further relevant information available. 10.5 Incompatible Materials: No further relevant information available. 10.6 Hazardous Decomposition Products:Possible in traces. Nitrogen oxides. SECTION 11 –TOXICOLOGICAL INFORMATION 11.1 Information on Toxicological Effects Acute Toxicity: LD/LC50 Values Relevant for Classification: None. Sensitisation:No sensitising effects known. Primary irritant effect: On the Skin: Not a skin irritant in unused form. Vapors/particles from used product are possibly irritating to skin. On the Eye: Not an eye irritant in unused form. Vapors/particles from used product are possibly irritating to eyes. Sensitisation: No sensitising effects known. Subacute to Chronic Toxicity:No further relevant information available. Acute Effects (Acute toxicity, Irritation and Corrosivity):Danger of blast or crush-type injuries. Repeated dose toxicity:No further relevant information available. SECTION 12 –ECOLOGICAL INFORMATION 12.1 Toxicity Aquatic Toxicity: No further relevant information available. 12.2 Persistence and Degradability:No further relevant information available. 12.3 Bioaccumulative Potential:No further relevant information available. 12.4 Mobility in Soil:No further relevant information available. Additional Ecological Information General Notes:Water hazard class 1 (German Regulation) (Self-assessment): slightly hazardous for water Do not allow undiluted product or large quantities of it to reach ground water, water course or sewage system. 12.5 Results of PBT and vPvB Assessment PBT: Not applicable. vPvB: Not applicable. 12.6 Other Adverse Effects:No further relevant information available. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 7 of 10 Safety Data Sheet SECTION 13 –DISPOSAL CONSIDERATIONS 13.1 Waste Treatment Methods: Recommendation:Must not be disposed together with household garbage. Do not allow product to reach sewage system.Damaged materials pose a danger to anyone in the immediate area; consult experts for disposal of damaged products. The user of this material has the responsibility to dispose of unused material, residues and containers in compliance with all relevant local, state and federal laws and regulations regarding treatment, storage and disposal for hazardous and nonhazardous wastes. Residual materials should be treated as hazardous. Uncleaned Packaging: Recommendation: Disposal must be made according to official regulations. SECTION 14 –TRANSPORT INFORMATION 14.1 UN-Number DOT, ADR, IMDG, IATA :UN0349 14.2 UN Proper Shipping Name DOT :For 10,000 ft spools with Wire Lock Terminations only: Not regulated as an explosive. ARTICLES, EXPLOSIVE, N.O.S. (CONTAINS CYCLOTETRAMETHYLENE TETRANITRAMINE) ADR :0349 ARTICLES, EXPLOSIVE, N.O.S. (CONTAINS CYCLOTETRAMETHYLENE TETRANITRAMINE) IMDG, IATA :ARTICLES, EXPLOSIVE, N.O.S. (CONTAINS CYCLOTETRAMETHYLENE TETRANITRAMINE) 14.3 Transport Hazard Class(es) DOT Class Label : : 1.4 1.4 ADR, IMDG, IATA Class Label : : 1.4 1.4S 14.4 Packing Group DOT, ADR, IMDG, IATA :II 14.5 Environmental Hazards: Marine Pollutant::No 14.6 Special Precautions for User: Not applicable. EMS Number :F-B, S-X 14.7 Transport in Bulk According to Annex II of MARPOL73/78 and the IBC Code:Not applicable. Transport/Additional information: ADR Limited Quantities (LQ):0 Excepted Quantities (EQ):Code: E0 Not permitted as Excepted Quantity UN “Model Regulation”:UN0349, ARTICLES, EXPLOSIVE, N.O.S., 1.4S, II According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 8 of 10 Safety Data Sheet SECTION 15 –REGULATORY INFORMATION 15.1 Safety, Health and Environmental Regulations/Legislation Specific for the Substance or Mixture United States (USA) SARA Section 355 (Extremely Hazardous Substances) None of the ingredients are listed. Section 313 (Specific Toxic Chemical Listings) None of the ingredients are listed. TSCA (Toxic Substances Control Act) All ingredients are listed. Proposition 65 (California) Chemicals known to cause cancer None of the ingredients is listed. Chemicals known to cause reproductive toxicity for females None of the ingredients are listed. Chemicals known to cause reproductive toxicity for males None of the ingredients are listed. Chemicals known to cause developmental toxicity None of the ingredients are listed. Carcinogenic Categories EPA (Environmental Protection Agency) 2691-41-0 octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX)D IARC (International Agency for Research on Cancer) None of the ingredients are listed. TLV (Threshold Limit Value established by ACGIH) 7429-90-5 aluminium powder (pyrophoric)A4 NIOSH-Ca (National Institute for Occupational Safety and Health) None of the ingredients are listed. Canada Canadian Domestic Substances List (DSL) All ingredients are listed. Canadian Ingredient Disclosure list (limit 0.1%) None of the ingredients are listed. Canadian Ingredient Disclosure list (limit 1%) None of the ingredients are listed. Other regulations, limitations and prohibitive regulations This product has been classified in accordance with hazard criteria of the Controlled Products Regulations and the SDS contains all the information required by the Controlled Products Regulations. Substances of very high concern (SVHC) according to REACH, Article 57 None of the ingredients are listed. 15.2 Chemical safety assessment:A Chemical Safety Assessment has not been carried out. According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 9 of 10 Safety Data Sheet SECTION 16 –OTHER INFORMATION Revision Date :07/20/2020 Other Information :This document has been prepared in accordance with the SDS requirements of the OSHA Hazard Communication Standard 29 CFR 1910.1200 Relevant Phrases x H201 Explosive; mass explosion hazard. x H250 Catches fire spontaneously if exposed to air. x H261 In contact with water releases flammable gases. x H301 Toxic if swallowed. x H311 Toxic in contact with skin. x R15 Contact with water liberates extremely flammable gases. x R17 Spontaneously flammable in air. x R2 Risk of explosion by shock, friction, fire or other sources of ignition. x R22 Harmful if swallowed. x R24 Toxic in contact with skin. Abbreviations and acronyms: x ADR: Accord européen sur le transport des marchandises dangereuses par Route (European Agreement concerning the International Carriage of Dangerous Goods by Road) x IMDG: International Maritime Code for Dangerous Goods x DOT: US Department of Transportation x IATA: International Air Transport Association x GHS: Globally Harmonised System of Classification and Labelling of Chemicals x ACGIH: American Conference of Governmental Industrial Hygienists x EINECS: European Inventory of Existing Commercial Chemical Substances x ELINCS: European List of Notified Chemical Substances x CAS: Chemical Abstracts Service (division of the American Chemical Society) x NFPA: National Fire Protection Association (USA) x HMIS: Hazardous Materials Identification System (USA) x WHMIS: Workplace Hazardous Materials Information System (Canada) x DNEL: Derived No-Effect Level (REACH) x PNEC: Predicted No-Effect Concentration (REACH) x LC50: Lethal concentration, 50 percent x LD50: Lethal dose, 50 percent x Expl. 1.1: Explosives, Division 1.1 x Expl. 1.4: Explosives, Division 1.4 x Pyr. Sol. 1: Pyorphoric Solids, Hazard Category 1 x Water-react. 2: Substances and Mixtures which, in contact with water, emit flammable gases, Hazard Category 2 x Acute Tox. 3: Acute toxicity, Hazard Category 3 According to: 1907/2006/EC (REACH), 1272/2008/EC (CLP), and OSHA GHS Trade Name: Shock Tube SDS# 1124 Date: 07/20/2020 Page 10 of 10 Safety Data Sheet Disclaimer Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, the information contained herein, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. The information contained herein is provided for reference purposes only and is intended only for persons having relevant technical skills. Because conditions and manner of use are outside of our control, the user is responsible for determining the conditions of safe use of the product. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product or information. Under no circumstances shall either Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. Dyno Nobel SDS Sources SDS Prepared by: ChemTel Inc. 1305 North Florida Avenue Tampa, Florida USA 33602-2902 Toll Free North America 1-888-255-3924 Intl. +01 813-248-0573 Website: www.chemtelinc.com Party Responsible for the Preparation of This Document Dyno Nobel Inc. 6440 S. Millrock Drive, Suite 150 Salt Lake City, Utah 84121 Phone: 801-364-4800 Product Disclaimer: Please see reverse side. TECHNICAL DATA SHEET TROJAN® SPARTAN® Cast Booster Properties SDS #1108 PRODUCT DESCRIPTION TROJAN SPARTAN cast boosters are detonator sensitive, high density, high energy molecular explosives avaliable in various sizes designed to optimize initiation of all booster sensitive explosives. All TROJAN SPARTAN boosters are manufactured with an internal through-tunnel and detonator well for easy application with either electric, electronic or nonelectric detonators or 10.6 g/m (50 gr/ft) minimum strength detonating cord. TROJAN SPARTAN boosters are formulated from the highest quality PETN and other high explosive materials ensuring reliability, consistency and durability in all blasting environments. The fluorescent green container and clear printing makes the TROJAN SPARTAN booster more visible on the blast site (as well as in low light situations) and reduces the possibility of misplaced charges. The redesigned Caplock™ holds the detonator in place more securely and makes it more difficult for the detonator to be pulled out of the capwell position while it is being lowered into the borehole. APPLICATION RECOMMENDATIONS • NEVER force the detonator into the through-tunnel, the detonator-well or otherwise attempt to clear these areas if obstructed. If the through-tunnel or detonator-well does not accommodate the detonator, do not use the booster. Notify your Dyno Nobel representative. Hazardous Shipping Description • UN 0042 Boosters, 1.1D PG II Density g/cc avg 1.65 Velocity m/sec ft/s 7,550 24,800 Detonation Pressure Kbars 235 Water Resistance 6 months with no loss of sensitivity Shelf Life Maximum 5 years from date of production Maximum Usage Temperature*66°C / 150°F *Never expose explosive materials to sources of heat exceeding 66°C (150°F) or to open flame, unless such materials or procedures for their use have been recommended for such exposure by the manufacturer. All Dyno Nobel Inc. energy and gas volume values except Velocity and Detonation Pressure are calculated using PRODET™ the computer code developed by Dyno Nobel Inc. for its exclusive use. Other computer codes may give different values. Velocity and Detonation Pressure are the result of empirical methods during May 2009. Product Disclaimer: Dyno Nobel Inc. and its subsidiaries disclaim any warranties with respect to this product, the safety or suitability thereof, or the results to be obtained, whether express or implied, INCLUDING WITHOUT LIMITATION, ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE AND/OR OTHER WARRANTY. Buyers and users assume all risk, responsibility and liability whatsoever from any and all injuries (including death), losses, or damages to persons or property arising from the use of this product. Under no circumstances shall Dyno Nobel Inc. or any of its subsidiaries be liable for special, consequential or incidental damages or for anticipated loss of profits. TECHNICAL DATA SHEET ADDITIONAL INFORMATION – Visit dynonobel.com for Brochures and Case Studies related to this product. Properties Cont. TROJAN® SPARTAN® Cast Booster APPLICATION RECOMMENDATIONS - continued • ALWAYS use detonating cord with a coreload of 10.6 g/m (50 gr/ft) or higher when initiating the TROJAN SPARTAN booster with detonating cord. • Minimum detonator is No. 8 strength for temperatures above -40º C (-40º F). A high strength detonator is recommended for temperatures below -40º C (-40º F). • Extremely low temperatures do not affect the performance of cast boosters with commercial detonators. Low temperatures do affect detonators and detonating cord. Be certain your initiation system is suitable for your application in extremely low temperatures. Cast boosters are more susceptible to breakage during handling in extremely cold temperatures. TRANSPORTATION, STORAGE AND HANDLING • Dyno Nobel cast boosters must be transported, stored, handled and used in conformity with all federal, state, provincial and local laws and regulations. • For maximum shelf life (5 years), Dyno Nobel cast boosters must be stored in a cool, dry, well ventilated magazine. Explosive inventory should be rotated. Avoid using new materials before the old. Case Dimensions 42 x 33 x 14 cm 16 ½ x 13 x 5 ½ in Packaging Unit Weight Unit Dimensions Case Quantity Gross Weight/Case goz Length Diameter kg lbscm in cm in 90* 3.2 11.9 4.7 2.7 1.1 150 14.0 30.9 150 5.5 11.9 4.7 3.6 1.4 95 15.0 33.1 200 7 11.7 4.6 4.1 1.6 72 15.6 34.4 350 12 11.9 4.7 5.0 2.0 49 17.6 38.9 400 14 11.9 4.7 5.5 2.2 40 16.8 37.0 450 16 11.9 4.7 5.8 2.3 36 17.4 38.3 900* 32 12.9 5.1 7.9 3.1 18 17.8 39.2 * The Caplock feature is not available on these boosters because the shells are made of cardboard instead of plastic. Note: All weights and dimensions are approximate. $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 6(&7,21±,'(17,),&$7,212)7+(68%67$1&(0,;785($1'2)7+(&203$1<81'(57$.,1* 1DPH$GGUHVVDQG7HOHSKRQHRIWKH5HVSRQVLEOH3DUW\ '\QR1REHO,QF 60LOOURFN'ULYH6XLWH 6DOW/DNH&LW\8WDK 3KRQH )D[ (0DLOGQQDKVH#DPG\QRQREHOFRP ZZZG\QRQREHOFRP 6'6 'DWH 6XSHUVHGHV 3URGXFW,GHQWLILHU 7UDGH1DPH&$67%2267(56 $UWLFOH1XPEHU 1RRWKHULGHQWLILHUV 2WKHU3URGXFW,GHQWLILHUV '<12&25'6(16,7,9(%2267(56&6&6&6&6 752-$163$57$1 752-$163$57$16OLGHU 752-$16WLQJHU 752-$11% 752-$11%81,9(56$/ 752-$17ZLQSOH[ 752-$163$57$165 752-$163$57$1&RQH 752-$15LQJSULPH 752-$163$57$1&68 752-$1:% 752-$16+,(/' 5HOHYDQW,GHQWLILHGXVHVRIWKH6XEVWDQFHRU0L[WXUHDQGXVHV$GYLVHG$JDLQVW 1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH $SSOLFDWLRQRIWKH6XEVWDQFHWKH0L[WXUH ([SORVLYHSURGXFW &RPPHUFLDOEODVWLQJDSSOLFDWLRQV (PHUJHQF\7HOHSKRQH1XPEHU &+(075(& 86&DQDGD ,QWHUQDWLRQDO 6(&7,21±+$=$5'6,'(17,),&$7,21 &ODVVLILFDWLRQRIWKH6XEVWDQFHRU0L[WXUH &ODVVLILFDWLRQ$FFRUGLQJWR5HJXODWLRQ(&1R &ODVVLILFDWLRQVOLVWHGDOVRDUHDSSOLFDEOHWRWKH26+$*+6+D]DUG&RPPXQLFDWLRQ6WDQGDUG&)5 H[SORGLQJERPE ([SO+([SORVLYHPDVVH[SORVLRQKD]DUG &ODVVLILFDWLRQ$FFRUGLQJWR'LUHFWLYH((&RU'LUHFWLYH(& $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW (([SORVLYH 55LVNRIH[SORVLRQE\VKRFNIULFWLRQILUHRURWKHUVRXUFHVRILJQLWLRQ ,QIRUPDWLRQ&RQFHUQLQJ3DUWLFXODU+D]DUGVIRU+XPDQDQG(QYLURQPHQW7KHSURGXFWKDVWREHODEHOOHGGXHWRWKH FDOFXODWLRQSURFHGXUHRIWKH³*HQHUDO&ODVVLILFDWLRQJXLGHOLQHIRUSUHSDUDWLRQVRIWKH(8´LQWKHODWHVWYDOLGYHUVLRQ &ODVVLILFDWLRQ6\VWHP7KHFODVVLILFDWLRQLVDFFRUGLQJWRWKHODWHVWHGLWLRQVRIWKH(8OLVWVDQGH[WHQGHGE\FRPSDQ\DQG OLWHUDWXUHGDWD 7KHFODVVLILFDWLRQLVLQDFFRUGDQFHZLWKWKHODWHVWHGLWLRQVRILQWHUQDWLRQDOVXEVWDQFHVOLVWVDQGLVVXSSOHPHQWHGE\ LQIRUPDWLRQIURPWHFKQLFDOOLWHUDWXUHDQGE\LQIRUPDWLRQSURYLGHGE\WKHFRPSDQ\ $GGLWLRQDO,QIRUPDWLRQ7KHUHDUHQRRWKHUKD]DUGVQRWRWKHUZLVHFODVVLILHGWKDWKDYHEHHQLGHQWLILHG SHUFHQWRIWKHPL[WXUHFRQVLVWVRIFRPSRQHQWVRIXQNQRZQWR[LFLW\ /DEHO(OHPHQWV /DEHOOLQJ$FFRUGLQJWR5HJXODWLRQ(&1R 7KHSURGXFWLVDGGLWLRQDOO\FODVVLILHGDQGODEHOOHGDFFRUGLQJWRWKH*OREDOO\+DUPRQL]HG6\VWHPZLWKLQWKH 8QLWHG6WDWHV*+6 7KHSURGXFWLVFODVVLILHGDQGODEHOOHGDFFRUGLQJWRWKH&/3UHJXODWLRQ +D]DUG3LFWRJUDPV *+6 6LJQDO:RUG'DQJHU +D]DUGGHWHUPLQLQJFRPSRQHQWVRIODEHOOLQJSHQWDHU\WKULWROWHWUDQLWUDWH3(71 RFWDK\GURWHWUDQLWURWHWUD]RFLQH+0; SHUK\GURWULQLWURWULD]LQH5'; WULQLWURWROXHQH717 DOXPLQLXPSRZGHUS\URSKRULF +D]DUGVWDWHPHQWV+([SORVLYHPDVVH[SORVLRQKD]DUG 3UHFDXWLRQDU\6WDWHPHQWV3.HHSDZD\IURPKHDWVSDUNVRSHQIODPHVKRWVXUIDFHV 1RVPRNLQJ 3'RQRWVXEMHFWWRJULQGLQJVKRFNIULFWLRQ 3:HDUSURWHFWLYHJORYHVSURWHFWLYHFORWKLQJH\H SURWHFWLRQIDFHSURWHFWLRQ 3'2127ILJKWILUHZKHQILUHUHDFKHVH[SORVLYHV 33,QFDVHRIILUH(YDFXDWHDUHD 3([SORVLRQULVNLQFDVHRIILUH 36WRUHLQDFFRUGDQFHZLWKORFDOUHJLRQDOQDWLRQDOLQWHUQDWLRQDO UHJXODWLRQV 3'LVSRVHRIFRQWHQWVFRQWDLQHULQDFFRUGDQFHZLWK ORFDOUHJLRQDOQDWLRQDOLQWHUQDWLRQDOUHJXODWLRQV +D]DUG'HVFULSWLRQ :+0,66\PEROV([SORVLYHSURGXFWVDUHQRWFODVVLILHGXQGHU:+0,6 1)3$5DWLQJVVFDOH1RWDYDLODEOH +0,65DWLQJVVFDOH1RWDYDLODEOH $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW +0,6/RQJ7HUP+HDOWK+D]DUG6XEVWDQFHV 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG 2WKHU+D]DUGV 5HVXOWVRI3%7DQGY3Y%$VVHVVPHQW 3%71RWDSSOLFDEOH Y3Y%1RWDSSOLFDEOH ([SORVLYH 3URGXFW 1RWLFH 35(9(17,21 2) $&&,'(176 ,1 7+( 86( 2) (;3/26,9(6 7KH SUHYHQWLRQ RI DFFLGHQWV LQ WKH XVH RI H[SORVLYHV LV D UHVXOW RI FDUHIXO SODQQLQJ DQG REVHUYDQFH RI WKH EHVW NQRZQ SUDFWLFHV 7KH H[SORVLYHVXVHUPXVWUHPHPEHUWKDWKHLVGHDOLQJZLWKDSRZHUIXOIRUFHDQGWKDWYDULRXVGHYLFHVDQGPHWKRGVKDYHEHHQ GHYHORSHGWRDVVLVWKLPLQGLUHFWLQJWKLVIRUFH+HVKRXOGUHDOL]HWKDWWKLVIRUFHLIPLVGLUHFWHGPD\HLWKHUNLOORULQMXUHERWK KLPDQGKLVIHOORZZRUNHUV :$51,1*$OOH[SORVLYHVDUHGDQJHURXVDQGPXVWEHFDUHIXOO\KDQGOHGDQGXVHGIROORZLQJDSSURYHGVDIHW\SURFHGXUHV HLWKHUE\RUXQGHUWKHGLUHFWLRQRIFRPSHWHQWH[SHULHQFHGSHUVRQVLQDFFRUGDQFHZLWKDOODSSOLFDEOHIHGHUDOVWDWHDQG ORFDOODZVUHJXODWLRQVRURUGLQDQFHV,I\RXKDYHDQ\TXHVWLRQVRUGRXEWVDVWRKRZWRXVHDQ\H[SORVLYHSURGXFW'2 127 86( ,7 EHIRUH FRQVXOWLQJ ZLWK \RXU VXSHUYLVRU RU WKH PDQXIDFWXUHU LI \RX GR QRW KDYH D VXSHUYLVRU ,I \RXU VXSHUYLVRUKDVDQ\TXHVWLRQVRUGRXEWVKHVKRXOGFRQVXOWWKHPDQXIDFWXUHUEHIRUHXVH 6(&7,21±&20326,7,21,1)250$7,2121,1*5(',(176 0L[WXUHV 'HVFULSWLRQ0L[WXUHRIVXEVWDQFHVOLVWHGEHORZZLWKQRQKD]DUGRXVDGGLWLRQV 'DQJHURXVFRPSRQHQWV &$6 (,1(&6 ,QGH[QXPEHU SHQWDHU\WKULWROWHWUDQLWUDWH3(71 (5 8QVW([SO+ &$6 (,1(&6 ,QGH[QXPEHU WULQLWURWROXHQH717 75(515 5 ([SO+ $FXWH7R[+$FXWH7R[+$FXWH7R[+ 67275(+ $TXDWLF&KURQLF+ &$6 DOXPLQXPPHWDO )5 :DWHUUHDFW+ &$6 (,1(&6 SHUK\GURWULQLWURWULD]LQH5'; 75(5 ([SO+ $FXWH7R[+ &$6 (,1(&6 RFWDK\GURWHWUDQLWURWHWUD]RFLQH+0; 75;Q5(5 ([SO+ $FXWH7R[+$FXWH7R[+ $GGLWLRQDO,QIRUPDWLRQ)RUWKHZRUGLQJRIWKHOLVWHGULVNSKUDVHVUHIHUWRVHFWLRQ )RUWKHOLVWHGLQJUHGLHQWVWKHLGHQWLW\DQGH[DFWSHUFHQWDJHVDUHEHLQJZLWKKHOGDVDWUDGHVHFUHW $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 6(&7,21±),567$,'0($685(6 'HVFULSWLRQRI)LUVW$LG0HDVXUHV *HQHUDO,QIRUPDWLRQ1RVSHFLDOPHDVXUHVUHTXLUHG $IWHU,QKDODWLRQ6XSSO\IUHVKDLUFRQVXOWGRFWRULQFDVHRIFRPSODLQWV $IWHU6NLQ&RQWDFW*HQHUDOO\WKHSURGXFWGRHVQRWLUULWDWHWKHVNLQ :DVKZLWKVRDSDQGZDWHU ,IVNLQLUULWDWLRQLVH[SHULHQFHGFRQVXOWDGRFWRU $IWHU(\H&RQWDFW5HPRYHFRQWDFWOHQVHVLIZRUQ 5LQVHRSHQHGH\HIRUVHYHUDOPLQXWHVXQGHUUXQQLQJZDWHU,IV\PSWRPVSHUVLVWFRQVXOWDGRFWRU $IWHU6ZDOORZLQJ'RQRWLQGXFHYRPLWLQJFDOOIRUPHGLFDOKHOSLPPHGLDWHO\ 0RVW,PSRUWDQW6\PSWRPVDQG(IIHFWV%RWK$FXWHDQG'HOD\HG %ODVWLQMXU\LIPLVKDQGOHG +D]DUGV'DQJHURIEODVWRUFUXVKW\SHLQMXULHV ,QGLFDWLRQRI$Q\,PPHGLDWH0HGLFDO$WWHQWLRQDQG6SHFLDO7UHDWPHQW1HHGHG 3URGXFWPD\SURGXFHSK\VLFDOLQMXU\LIPLVKDQGOHG7UHDWPHQWRIWKHVHLQMXULHVVKRXOGEHEDVHGRQWKHEODVWDQG FRPSUHVVLRQHIIHFWV 6(&7,21±),5(),*+7,1*0($685(6 ([WLQJXLVKLQJ0HGLD 6XLWDEOH([WLQJXLVKLQJ$JHQWV'2127ILJKWILUHZKHQILUHUHDFKHVH[SORVLYHV )RU6DIHW\5HDVRQV8QVXLWDEOH([WLQJXLVKLQJ$JHQWV1RQH 6SHFLDO+D]DUGV$ULVLQJIURPWKH6XEVWDQFHRU0L[WXUH '2127$77(03772),*+7),5(6,192/9,1*(;3/26,9(0$7(5,$/6(YDFXDWHDOOSHUVRQQHOWRDSUHGHWHUPLQHG VDIHORFDWLRQQROHVVWKDQIHHWLQDOOGLUHFWLRQV&DQH[SORGHRUGHWRQDWHXQGHUILUHFRQGLWLRQV%XUQLQJPDWHULDO PD\SURGXFHWR[LFYDSRUV,WLVUHFRPPHQGHGWKDWXVHUVRIH[SORVLYHVPDWHULDOEHIDPLOLDUZLWKWKH,QVWLWXWHRI0DNHUVRI ([SORVLYHV6DIHW\/LEUDU\SXEOLFDWLRQV ([SORVLYHPDVVH[SORVLRQKD]DUG $GYLFHIRU)LUHILJKWHUV 3URWHFWLYH(TXLSPHQW:HDUVHOIFRQWDLQHGUHVSLUDWRU\SURWHFWLYHGHYLFH :HDUIXOO\SURWHFWLYHVXLW $GGLWLRQDO,QIRUPDWLRQ (OLPLQDWHDOOLJQLWLRQVRXUFHVLIVDIHWRGRVR)ODPPDELOLW\&ODVVLILFDWLRQGHILQHGE\&)5([SORVLYH&DQ H[SORGHXQGHUILUHFRQGLWLRQV,QGLYLGXDOGHYLFHVZLOOUDQGRPO\H[SORGH0DVVH[SORVLRQRIPXOWLSOHGHYLFHVLVSRVVLEOH XQGHUFHUWDLQFRQGLWLRQV%XUQLQJPDWHULDOPD\SURGXFHWR[LFDQGLUULWDWLQJYDSRUV,QXQXVXDOFDVHVVKUDSQHOPD\EH WKURZQIURPH[SORGLQJGHYLFHVXQGHUFRQWDLQPHQW6HH(PHUJHQF\UHVSRQVH*XLGHERRNIRUIXUWKHULQIRUPDWLRQ 6(&7,21±$&&,'(17$/5(/($6(0($685(6 3HUVRQDO3UHFDXWLRQV3URWHFWLYH(TXLSPHQWDQG(PHUJHQF\3URFHGXUHV (YDFXDWHDUHD :HDUSURWHFWLYHFORWKLQJ (QVXUHDGHTXDWHYHQWLODWLRQ .HHSDZD\IURPLJQLWLRQVRXUFHV 3URWHFWIURPKHDW ,VRODWHDUHDDQGSUHYHQWDFFHVV (QYLURQPHQWDO3UHFDXWLRQV 1RVSHFLDOPHDVXUHVUHTXLUHG 0HWKRGVDQG0DWHULDOIRU&RQWDLQPHQWDQG&OHDQLQJ8S 3LFNXSPHFKDQLFDOO\ 6HQGIRUUHFRYHU\RUGLVSRVDOLQVXLWDEOHUHFHSWDFOHV 'LVSRVHXQXVDEOHPDWHULDODVZDVWHDFFRUGLQJWRLWHP $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 5HIHUHQFHWR2WKHU6HFWLRQV 6HH6HFWLRQIRULQIRUPDWLRQRQVDIHKDQGOLQJ 6HH6HFWLRQIRULQIRUPDWLRQRQSHUVRQDOSURWHFWLRQHTXLSPHQW 6HH6HFWLRQIRUGLVSRVDOLQIRUPDWLRQ 6(&7,21±+$1'/,1*$1'6725$*( 3UHFDXWLRQVIRU6DIH+DQGOLQJ 2SHQDQGKDQGOHUHFHSWDFOHZLWKFDUH +DQGOHZLWKFDUH$YRLGMROWLQJIULFWLRQDQGLPSDFW 8VHRQO\LQZHOOYHQWLODWHGDUHDV 'RQRWVXEMHFWWRJULQGLQJVKRFNIULFWLRQ ,QIRUPDWLRQ$ERXW)LUHDQG([SORVLRQ3URWHFWLRQ.HHSLJQLWLRQVRXUFHVDZD\'RQRWVPRNH3URWHFWIURPKHDW 3UHYHQWLPSDFWDQGIULFWLRQ(PHUJHQF\FRROLQJPXVWEHDYDLODEOHLQFDVHRIQHDUE\ILUH &RQGLWLRQVIRU6DIH6WRUDJH,QFOXGLQJ$Q\,QFRPSDWLELOLWLHV6WRUDJH 5HTXLUHPHQWVWREH0HWE\6WRUHURRPVDQG5HFHSWDFOHV6WRUHLQDFRROORFDWLRQ $YRLGVWRUDJHQHDUH[WUHPHKHDWLJQLWLRQVRXUFHVRURSHQIODPH ,QIRUPDWLRQ$ERXW6WRUDJHLQ2QH&RPPRQ6WRUDJH)DFLOLW\6WRUHDZD\IURPIRRGVWXIIV 6WRUHDZD\IURPR[LGLVLQJDJHQWV )XUWKHU,QIRUPDWLRQ$ERXW6WRUDJH&RQGLWLRQV6WRUHXQGHUORFNDQGNH\DQGZLWKDFFHVVUHVWULFWHGWRWHFKQLFDO H[SHUWVRUWKHLUDVVLVWDQWVRQO\ .HHSDZD\IURPKHDW 6SHFLILF(QG8VHV1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 6(&7,21±(;32685(&21752/63(5621$/3527(&7,21 $GGLWLRQDO,QIRUPDWLRQ$ERXW'HVLJQRI7HFKQLFDO)DFLOLWLHV1RIXUWKHUGDWDVHHLWHP &RQWURO3DUDPHWHUV ,QJUHGLHQWVZLWK/LPLW9DOXHVWKDW5HTXLUH0RQLWRULQJDWWKH:RUNSODFH WULQLWURWROXHQH717 3(/86$/RQJWHUPYDOXHPJPñ 6NLQ 5(/86$/RQJWHUPYDOXHPJPñ 6NLQ 7/986$/RQJWHUPYDOXHPJPñ 6NLQ%(,0 (/&DQDGD/RQJWHUPYDOXHPJPñ 6NLQ (9&DQDGD6KRUWWHUPYDOXHPJPñSSP /RQJWHUPYDOXHPJPñSSP 6NLQ DOXPLQXPPHWDO 3(/86$/RQJWHUPYDOXH PJPñ 7RWDOGXVW 5HVSLUDEOHIUDFWLRQ 5(/86$/RQJWHUPYDOXH PJPñ DV$O 7RWDOGXVW 5HVSLUDEOHS\URSRZGZHOGLQJI 7/986$/RQJWHUPYDOXH PJPñ DV$O DVUHVSLUDEOHIUDFWLRQ (/&DQDGD/RQJWHUPYDOXHPJPñ UHVSLUDEOHDV$O $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW (9&DQDGD/RQJWHUPYDOXHPJPñ DOXPLQLXPFRQWDLQLQJDVDOXPLQLXP SHUK\GURWULQLWURWULD]LQH5'; 5(/86$6KRUWWHUPYDOXHPJPñ /RQJWHUPYDOXHPJPñ 6NLQ 7/986$/RQJWHUPYDOXHPJPñ 6NLQ (/&DQDGD/RQJWHUPYDOXHPJPñ 6NLQ (9&DQDGD/RQJWHUPYDOXHPJPñ 6NLQ '1(/V1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 31(&V1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH ,QJUHGLHQWVZLWKELRORJLFDOOLPLWYDOXHV WULQLWURWROXHQH717 %(,86$RIKHPRJORELQ 0HGLXPEORRG 7LPHGXULQJRUHQGRIVKLIW 3DUDPHWHU0HWKHPRJORELQEDFNJURXQGQRQVSHFLILFVHPLTXDQWLWDWLYH $GGLWLRQDO,QIRUPDWLRQ7KHOLVWVYDOLGGXULQJWKHPDNLQJZHUHXVHGDVEDVLV ([SRVXUH&RQWUROV 3HUVRQDO3URWHFWLYH(TXLSPHQW *HQHUDO3URWHFWLYHDQG+\JLHQLF0HDVXUHV7KHXVXDOSUHFDXWLRQDU\PHDVXUHVDUHWREHDGKHUHGWRZKHQKDQGOLQJ FKHPLFDOV .HHSLJQLWLRQVRXUFHVDZD\'RQRWVPRNH .HHSDZD\IURPIRRGVWXIIVEHYHUDJHVDQGIHHG :DVKKDQGVEHIRUHEUHDNVDQGDWWKHHQGRIZRUN 5HVSLUDWRU\3URWHFWLRQ1RWUHTXLUHGXQGHUQRUPDOFRQGLWLRQVRIXVH 5HVSLUDWRU\SURWHFWLRQPD\EHUHTXLUHGDIWHUSURGXFWXVH 3URWHFWLRQRI+DQGV:HDUJORYHVIRUWKHSURWHFWLRQDJDLQVWPHFKDQLFDOKD]DUGVDFFRUGLQJWR1,26+RU(1 7KHJORYHPDWHULDOKDVWREHLPSHUPHDEOHDQGUHVLVWDQWWRWKHSURGXFWWKHVXEVWDQFHWKHSUHSDUDWLRQ 6HOHFWLRQRIWKHJORYHPDWHULDORQFRQVLGHUDWLRQRIWKHSHQHWUDWLRQWLPHVUDWHVRIGLIIXVLRQDQGWKHGHJUDGDWLRQ 0DWHULDORI*ORYHV7KHVHOHFWLRQRIWKHVXLWDEOHJORYHVGRHVQRWRQO\GHSHQGRQWKHPDWHULDOEXWDOVRRQIXUWKHU PDUNVRITXDOLW\DQGYDULHVIURPPDQXIDFWXUHUWRPDQXIDFWXUHU$VWKHSURGXFWLVDSUHSDUDWLRQRIVHYHUDO VXEVWDQFHVWKHUHVLVWDQFHRIWKHJORYHPDWHULDOFDQQRWEHFDOFXODWHGLQDGYDQFHDQGKDVWKHUHIRUHWREHFKHFNHG SULRUWRWKHDSSOLFDWLRQ 3HQHWUDWLRQ7LPHRI*ORYH0DWHULDO7KH H[DFW EUHDN WKURXJK WLPHPXVW EH IRXQG RXW E\ WKH PDQXIDFWXUHU RI WKH SURWHFWLYHJORYHVDQGKDVWREHREVHUYHG (\H3URWHFWLRQ 6DIHW\JODVVHV )DFHSURWHFWLRQ %RG\3URWHFWLRQ,PSHUYLRXVSURWHFWLYHFORWKLQJ /LPLWDWLRQDQG6XSHUYLVLRQRI([SRVXUHLQWRWKH(QYLURQPHQW1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 5LVN0DQDJHPHQW0HDVXUHV2UJDQL]DWLRQDOPHDVXUHVVKRXOGEHLQSODFHIRUDOODFWLYLWLHVLQYROYLQJWKLVSURGXFW $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 6(&7,21±3+<6,&$/$1'&+(0,&$/3523(57,(6 ,QIRUPDWLRQRQ%DVLF3K\VLFDODQG&KHPLFDO3URSHUWLHV *HQHUDO,QIRUPDWLRQ $SSHDUDQFH )RUP 6ROLGPDWHULDO &RORXU $FFRUGLQJWRSURGXFWVSHFLILFDWLRQ 2GRXU 2GRXUOHVV 2GRXU7KUHVKROG 1RWGHWHUPLQHG S+9DOXH 1RWDSSOLFDEOH &KDQJHLQ&RQGLWLRQ 0HOWLQJSRLQW0HOWLQJUDQJH &)WULQLWURWROXHQH %RLOLQJSRLQW%RLOLQJUDQJH 8QGHWHUPLQHG )ODVK3RLQW 1RWDSSOLFDEOH )ODPPDELOLW\VROLGJDVHRXV ([SORVLYHPDVVH[SORVLRQKD]DUG $XWR6HOILJQLWLRQWHPSHUDWXUH 1RWGHWHUPLQHG 'HFRPSRVLWLRQWHPSHUDWXUH 1RWGHWHUPLQHG 6HOILJQLWLQJ 3URGXFWLVQRWVHOILJQLWLQJ 'DQJHURIH[SORVLRQ 5LVNRIH[SORVLRQE\VKRFNIULFWLRQILUHRURWKHUVRXUFHVRILJQLWLRQ ([SORVLRQOLPLWV /RZHU 1RWGHWHUPLQHG 8SSHU 1RWGHWHUPLQHG 9DSRXUSUHVVXUH 1RWDSSOLFDEOH 'HQVLW\DW&) JFPñOEVJDO 5HODWLYHGHQVLW\ 1RWGHWHUPLQHG 9DSRXUGHQVLW\ 1RWDSSOLFDEOH (YDSRUDWLRQUDWH 1RWDSSOLFDEOH 6ROXELOLW\LQ0LVFLELOLW\ZLWKZDWHU 9DULDEOHGHSHQGHQWXSRQSURGXFWFRPSRVLWLRQDQGSDFNDJLQJ 3DUWLWLRQFRHIILFLHQWQRFWDQROZDWHU 1RWGHWHUPLQHG 9LVFRVLW\ '\QDPLF 1RWDSSOLFDEOH .LQHPDWLF 1RWDSSOLFDEOH 2WKHU,QIRUPDWLRQ 1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 6(&7,21±67$%,/,7<$1'5($&7,9,7< 5HDFWLYLW\ &KHPLFDO6WDELOLW\ 7KHUPDO'HFRPSRVLWLRQ&RQGLWLRQVWREH$YRLGHG1RGHFRPSRVLWLRQLIXVHGDQGVWRUHGDFFRUGLQJWRVSHFLILFDWLRQV .HHSDZD\IURPKHDWVSDUNVRSHQIODPHVKRWVXUIDFHV1RVPRNLQJ 3RVVLELOLW\RI+D]DUGRXV5HDFWLRQV'DQJHURIH[SORVLRQ7R[LFIXPHVPD\EHUHOHDVHGLIKHDWHGDERYHWKH GHFRPSRVLWLRQSRLQW &RQGLWLRQVWR$YRLG.HHSLJQLWLRQVRXUFHVDZD\'RQRWVPRNH ,QFRPSDWLEOH0DWHULDOV1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH +D]DUGRXV'HFRPSRVLWLRQ3URGXFWV&DUERQPRQR[LGHDQGFDUERQGLR[LGH 1LWURJHQR[LGHV+\GURFDUERQV $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 6(&7,21±72;,&2/2*,&$/,1)250$7,21 ,QIRUPDWLRQRQWR[LFRORJLFDOHIIHFWV $FXWHWR[LFLW\ /'/&YDOXHVUHOHYDQWIRUFODVVLILFDWLRQ1RQH 3ULPDU\LUULWDQWHIIHFW 2QWKH6NLQ1RWDVNLQLUULWDQWLQXQXVHGIRUP9DSRUVSDUWLFOHVIURPXVHGSURGXFWDUHSRVVLEO\LUULWDWLQJWRVNLQ 2QWKH(\H1RWDQH\HLUULWDQWLQXQXVHGIRUP9DSRUVSDUWLFOHVIURPXVHGSURGXFWDUHSRVVLEO\LUULWDWLQJWRH\HV 6HQVLWLVDWLRQ1RVHQVLWLVLQJHIIHFWVNQRZQ 6XEDFXWHWR&KURQLF7R[LFLW\1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH $FXWH(IIHFWV$FXWH7R[LFLW\,UULWDWLRQDQG&RUURVLYLW\'DQJHURIEODVWRUFUXVKW\SHLQMXULHV 5HSHDWHG'RVH7R[LFLW\1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 6(&7,21±(&2/2*,&$/,1)250$7,21 7R[LFLW\ $TXDWLF7R[LFLW\7R[LFIRUDTXDWLFRUJDQLVPV 3HUVLVWHQFHDQG'HJUDGDELOLW\1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH %LRDFFXPXODWLYH3RWHQWLDO1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 0RELOLW\LQ6RLO1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH (FRWR[LFDOHIIHFWV 5HPDUN7R[LFIRUILVK $GGLWLRQDO(FRORJLFDO,QIRUPDWLRQ *HQHUDO1RWHV:DWHUKD]DUGFODVV*HUPDQ5HJXODWLRQ6HOIDVVHVVPHQWH[WUHPHO\KD]DUGRXVIRUZDWHU 'RQRWDOORZSURGXFWWRUHDFKJURXQGZDWHUZDWHUFRXUVHRUVHZDJHV\VWHPHYHQLQVPDOOTXDQWLWLHV 'DQJHUWRGULQNLQJZDWHULIHYHQH[WUHPHO\VPDOOTXDQWLWLHVOHDNLQWRWKHJURXQG $OVRSRLVRQRXVIRUILVKDQGSODQNWRQLQZDWHUERGLHV 7R[LFIRUDTXDWLFRUJDQLVPV 'XHWRDYDLODEOHGDWDRQHOLPLQDELOLW\GHFRPSRVLWLRQDQGELRDFFXPXODWLRQSRWHQWLDOSURORQJHGWHUPGDPDJHRIWKH HQYLURQPHQWFDQQRWEHH[FOXGHG 5HVXOWVRI3%7DQGY3Y%$VVHVVPHQW3%71RWDSSOLFDEOH Y3Y%1RWDSSOLFDEOH 2WKHU$GYHUVH(IIHFWV1RIXUWKHUUHOHYDQWLQIRUPDWLRQDYDLODEOH 6(&7,21±',6326$/&216,'(5$7,216 :DVWH7UHDWPHQW0HWKRGV 5HFRPPHQGDWLRQ0XVWQRWEHGLVSRVHGWRJHWKHUZLWKKRXVHKROGJDUEDJH'RQRWDOORZSURGXFWWRUHDFKVHZDJH V\VWHP'DPDJHGPDWHULDOVSRVHDGDQJHUWRDQ\RQHLQWKHLPPHGLDWHDUHDFRQVXOWH[SHUWVIRUGLVSRVDORIGDPDJHG SURGXFWV 7KHXVHURIWKLVPDWHULDOKDVWKHUHVSRQVLELOLW\WRGLVSRVHRIXQXVHGPDWHULDOUHVLGXHVDQGFRQWDLQHUVLQFRPSOLDQFHZLWK DOOUHOHYDQWORFDOVWDWHDQGIHGHUDOODZVDQGUHJXODWLRQVUHJDUGLQJWUHDWPHQWVWRUDJHDQGGLVSRVDOIRUKD]DUGRXVDQG QRQKD]DUGRXVZDVWHV5HVLGXDOPDWHULDOVVKRXOGEHWUHDWHGDVKD]DUGRXV 8QFOHDQHG3DFNDJLQJ 5HFRPPHQGDWLRQ'LVSRVDOPXVWEHPDGHDFFRUGLQJWRRIILFLDOUHJXODWLRQV 6(&7,21±75$163257,1)250$7,21 811XPEHU '27$'5,0'* 81 ,$7$ )25%,''(1 $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 813URSHU6KLSSLQJ1DPH '27,0'* %RRVWHUVZLWKRXWGHWRQDWRU $'5 %2267(56:,7+287'(721$725 ,$7$ )25%,''(1 7UDQVSRUW+D]DUG&ODVVHV '27$'5,0'* &ODVV /DEHO ' ,$7$ &ODVV )25%,''(1 3DFNLQJ*URXS '27$'5,0'* ,, ,$7$ )25%,''(1 (QYLURQPHQWDO+D]DUGV 0DULQH3ROOXWDQW 1R 6SHFLDO0DUNLQJ,$7$ 3URKLELWHGIURP7UDQVSRUWLQ3DVVHQJHU$LUFUDIW 6SHFLDO3UHFDXWLRQVIRU8VHU1RWDSSOLFDEOH (061XPEHU )%6; 7UDQVSRUWLQ%XON$FFRUGLQJWR$QQH[,,RI0$532/DQGWKH,%&&RGH 7UDQVSRUW$GGLWLRQDOLQIRUPDWLRQ 1RWDSSOLFDEOH $'5 /LPLWHGTXDQWLWLHV/4 ([FHSWHGTXDQWLWLHV(4 &RGH( 1RWSHUPLWWHGDV([FHSWHG4XDQWLW\ 7XQQHOUHVWULFWLRQFRGH ,0'* /LPLWHG4XDQWLWLHV/4 ([FHSWHG4XDQWLWLHV(4 &RGH( 1RWSHUPLWWHGDV([FHSWHG4XDQWLW\ ,$7$ )25%,''(1 81³0RGHO5HJXODWLRQ´ 81%2267(56:,7+287'(721$725',, 6(&7,21±5(*8/$725<,1)250$7,21 6DIHW\+HDOWKDQG(QYLURQPHQWDO5HJXODWLRQV/HJLVODWLRQ6SHFLILFIRUWKH6XEVWDQFHRU0L[WXUH 8QLWHG6WDWHV86$ 6$5$ 6HFWLRQ([WUHPHO\+D]DUGRXV6XEVWDQFHV 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG 6HFWLRQ6SHFLILF7R[LF&KHPLFDO/LVWLQJV DOXPLQXPPHWDO 76&$7R[LF6XEVWDQFHV&RQWURO$FW $OOLQJUHGLHQWVDUHOLVWHG 3URSRVLWLRQ&DOLIRUQLD &KHPLFDOVNQRZQWRFDXVHFDQFHU WULQLWURWROXHQH717 &KHPLFDOVNQRZQWRFDXVHUHSURGXFWLYHWR[LFLW\IRUIHPDOHV 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &KHPLFDOVNQRZQWRFDXVHUHSURGXFWLYHWR[LFLW\IRUPDOHV $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &KHPLFDOVNQRZQWRFDXVHGHYHORSPHQWDOWR[LFLW\ 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &DUFLQRJHQLF&DWHJRULHV (3$(QYLURQPHQWDO3URWHFWLRQ$JHQF\ WULQLWURWROXHQH717& SHUK\GURWULQLWURWULD]LQH5';& RFWDK\GURWHWUDQLWURWHWUD]RFLQH+0;' ,$5&,QWHUQDWLRQDO$JHQF\IRU5HVHDUFKRQ&DQFHU WULQLWURWROXHQH717 7/97KUHVKROG/LPLW9DOXHHVWDEOLVKHGE\$&*,+ DOXPLQXPPHWDO$ SHUK\GURWULQLWURWULD]LQH5';$ 1,26+&D1DWLRQDO,QVWLWXWHIRU2FFXSDWLRQDO6DIHW\DQG+HDOWK 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &DQDGD &DQDGLDQ'RPHVWLF6XEVWDQFHV/LVW'6/ $OOLQJUHGLHQWVDUHOLVWHG &DQDGLDQ,QJUHGLHQW'LVFORVXUHOLVWOLPLW 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &DQDGLDQ,QJUHGLHQW'LVFORVXUHOLVWOLPLW WULQLWURWROXHQH717 DOXPLQXPPHWDO 2WKHUUHJXODWLRQVOLPLWDWLRQVDQGSURKLELWLYHUHJXODWLRQV 7KLVSURGXFWKDVEHHQFODVVLILHGLQDFFRUGDQFHZLWKKD]DUGFULWHULDRIWKH&RQWUROOHG3URGXFWV5HJXODWLRQVDQGWKH 6'6FRQWDLQVDOOWKHLQIRUPDWLRQUHTXLUHGE\WKH&RQWUROOHG3URGXFWV5HJXODWLRQV 6XEVWDQFHVRIYHU\KLJKFRQFHUQ69+&DFFRUGLQJWR5($&+$UWLFOH 1RQHRIWKHLQJUHGLHQWVDUHOLVWHG &KHPLFDOVDIHW\DVVHVVPHQW$&KHPLFDO6DIHW\$VVHVVPHQWKDVQRWEHHQFDUULHGRXW 6(&7,21±27+(5,1)250$7,21 5HYLVLRQ'DWH 2WKHU,QIRUPDWLRQ 5HOHYDQW3KUDVHV x +8QVWDEOHH[SORVLYHV x +([SORVLYHPDVVH[SORVLRQKD]DUG x +,QFRQWDFWZLWKZDWHUUHOHDVHVIODPPDEOHJDVHVZKLFKPD\LJQLWHVSRQWDQHRXVO\ x +7R[LFLIVZDOORZHG x +7R[LFLQFRQWDFWZLWKVNLQ x +7R[LFLILQKDOHG x +&DXVHVVNLQLUULWDWLRQ x +0D\FDXVHGDPDJHWRRUJDQVWKURXJKSURORQJHGRUUHSHDWHGH[SRVXUH x +7R[LFWRDTXDWLFOLIHZLWKORQJODVWLQJHIIHFWV x 5&RQWDFWZLWKZDWHUOLEHUDWHVH[WUHPHO\IODPPDEOHJDVHV x 55LVNRIH[SORVLRQE\VKRFNIULFWLRQILUHRURWKHUVRXUFHVRILJQLWLRQ x 5+DUPIXOLIVZDOORZHG $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW x 57R[LFE\LQKDODWLRQLQFRQWDFWZLWKVNLQDQGLIVZDOORZHG x 57R[LFLQFRQWDFWZLWKVNLQ x 57R[LFLIVZDOORZHG x 5([WUHPHULVNRIH[SORVLRQE\VKRFNIULFWLRQILUHRURWKHUVRXUFHVRILJQLWLRQ x 5'DQJHURIFXPXODWLYHHIIHFWV x 57R[LFWRDTXDWLFRUJDQLVPVPD\FDXVHORQJWHUPDGYHUVHHIIHFWVLQWKHDTXDWLFHQYLURQPHQW $EEUHYLDWLRQVDQGDFURQ\PV x $'5$FFRUGHXURSpHQVXUOHWUDQVSRUWGHVPDUFKDQGLVHVGDQJHUHXVHVSDU5RXWH(XURSHDQ$JUHHPHQW FRQFHUQLQJWKH,QWHUQDWLRQDO&DUULDJHRI'DQJHURXV*RRGVE\5RDG x ,0'*,QWHUQDWLRQDO0DULWLPH&RGHIRU'DQJHURXV*RRGV x '2786'HSDUWPHQWRI7UDQVSRUWDWLRQ x ,$7$,QWHUQDWLRQDO$LU7UDQVSRUW$VVRFLDWLRQ x *+6*OREDOO\+DUPRQLVHG6\VWHPRI&ODVVLILFDWLRQDQG/DEHOOLQJRI&KHPLFDOV x $&*,+$PHULFDQ&RQIHUHQFHRI*RYHUQPHQWDO,QGXVWULDO+\JLHQLVWV x (,1(&6(XURSHDQ,QYHQWRU\RI([LVWLQJ&RPPHUFLDO&KHPLFDO6XEVWDQFHV x (/,1&6(XURSHDQ/LVWRI1RWLILHG&KHPLFDO6XEVWDQFHV x &$6&KHPLFDO$EVWUDFWV6HUYLFHGLYLVLRQRIWKH$PHULFDQ&KHPLFDO6RFLHW\ x 1)3$1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ86$ x +0,6+D]DUGRXV0DWHULDOV,GHQWLILFDWLRQ6\VWHP86$ x :+0,6:RUNSODFH+D]DUGRXV0DWHULDOV,QIRUPDWLRQ6\VWHP&DQDGD x '1(/'HULYHG1R(IIHFW/HYHO5($&+ x 31(&3UHGLFWHG1R(IIHFW&RQFHQWUDWLRQ5($&+ x /&/HWKDOFRQFHQWUDWLRQSHUFHQW x /'/HWKDOGRVHSHUFHQW x ([SO([SORVLYHV'LYLVLRQ x 8QVW([SO([SORVLYHV8QVWDEOHH[SORVLYHV x :DWHUUHDFW6XEVWDQFHVDQG0L[WXUHVZKLFKLQFRQWDFWZLWKZDWHUHPLWIODPPDEOHJDVHV+D]DUG&DWHJRU\ x $FXWH7R[$FXWHWR[LFLW\+D]DUG&DWHJRU\ x 67275(6SHFLILFWDUJHWRUJDQWR[LFLW\5HSHDWHGH[SRVXUH+D]DUG&DWHJRU\ x $TXDWLF&KURQLF+D]DUGRXVWRWKHDTXDWLFHQYLURQPHQW&KURQLF+D]DUG&DWHJRU\ 6RXUFHV 6'63UHSDUHGE\ &KHP7HO,QF 1RUWK)ORULGD$YHQXH 7DPSD)ORULGD86$ 7ROO)UHH1RUWK$PHULFD,QWO :HEVLWHZZZFKHPWHOLQFFRP 3DUW\5HVSRQVLEOHIRUWKH3UHSDUDWLRQRI7KLV'RFXPHQW '\QR1REHO,QF 60LOOURFN'ULYH6XLWH 6DOW/DNH&LW\8WDK 3KRQH $FFRUGLQJWR(&5($&+(&&/3DQG26+$*+6 7UDGH1DPH&$67%2267(56 6'6'DWH3DJHRI 6DIHW\'DWD6KHHW 'LVFODLPHU '\QR1REHO,QFDQGLWVVXEVLGLDULHVGLVFODLPDQ\ZDUUDQWLHVZLWKUHVSHFWWRWKLVSURGXFWWKHVDIHW\RUVXLWDELOLW\WKHUHRIWKHLQIRUPDWLRQ FRQWDLQHGKHUHLQRUWKHUHVXOWVWREHREWDLQHGZKHWKHUH[SUHVVRULPSOLHG,1&/8',1*:,7+287/,0,7$7,21$1<,03/,(' :$55$17<2)0(5&+$17$%,/,7<25),71(66)25$3$57,&8/$5385326($1'2527+(5:$55$17<7KHLQIRUPDWLRQ FRQWDLQHGKHUHLQLVSURYLGHGIRUUHIHUHQFHSXUSRVHVRQO\DQGLVLQWHQGHGRQO\IRUSHUVRQVKDYLQJUHOHYDQWWHFKQLFDOVNLOOV%HFDXVH FRQGLWLRQVDQGPDQQHURIXVHDUHRXWVLGHRIRXUFRQWUROWKHXVHULVUHVSRQVLEOHIRUGHWHUPLQLQJWKHFRQGLWLRQVRIVDIHXVHRIWKH SURGXFW%X\HUVDQGXVHUVDVVXPHDOOULVNUHVSRQVLELOLW\DQGOLDELOLW\ZKDWVRHYHUIURPDQ\DQGDOOLQMXULHVLQFOXGLQJGHDWKORVVHVRU GDPDJHVWRSHUVRQVRUSURSHUW\DULVLQJIURPWKHXVHRIWKLVSURGXFWRULQIRUPDWLRQ8QGHUQRFLUFXPVWDQFHVVKDOOHLWKHU'\QR1REHO ,QFRUDQ\RILWVVXEVLGLDULHVEHOLDEOHIRUVSHFLDOFRQVHTXHQWLDORULQFLGHQWDOGDPDJHVRUIRUDQWLFLSDWHGORVVRISURILWV '\QR1REHO6'6